F271814

General Info

Members Datasets Scaffolds Average Seq Length
178 122 178 90

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100108004|Ga0075428_1001080042
Length 101
Sequence MMRWWRRRRQDHAADPLVCQEFVELVTDYLEGKLPDTDRTRFEAHLAECDGCAGYLEDMRRLVGSLNLVAEPPPDPETREALTRAFRELRGDTEPRDGDLR

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
101 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
102 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
103 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
104 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
105 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
106 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
114 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
115 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
116 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
117 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
118 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
119 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
120 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
121 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
122 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.31
Stem 0
Stem Tuber 0
Unclassified 1.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10004069 3300003373 Bacteria 3552
2 JGI25407J50210_10009659 3300003373 Bacteria 2448
3 JGI25407J50210_10026909 3300003373 Bacteria 1491
4 Ga0070658_10113462 3300005327 Bacteria 2247
5 Ga0070676_10245628 3300005328 Unclassified 1192
6 Ga0070676_11233065 3300005328 Bacteria 569
7 Ga0070676_11296089 3300005328 Bacteria 556
8 Ga0068869_100253335 3300005334 Bacteria 1407
9 Ga0070680_100491395 3300005336 Bacteria 1050
10 Ga0068868_102359035 3300005338 Bacteria 508
11 Ga0070660_100953217 3300005339 Unclassified 724
12 Ga0070660_100987403 3300005339 Bacteria 711
13 Ga0070691_10479818 3300005341 Bacteria 715
14 Ga0070661_100477648 3300005344 Bacteria 995
15 Ga0070692_10945768 3300005345 Bacteria 599
16 Ga0070668_100907124 3300005347 Unclassified 788
17 Ga0070674_100325285 3300005356 Bacteria 1234
18 Ga0070688_101296365 3300005365 Bacteria 588
19 Ga0070659_101566844 3300005366 Bacteria 588
20 Ga0070659_102156620 3300005366 Unclassified 501
21 Ga0070710_10111736 3300005437 Bacteria 1642
22 Ga0070701_10196146 3300005438 Bacteria 1191
23 Ga0070663_101694290 3300005455 Bacteria 565
24 Ga0070662_100129295 3300005457 Bacteria 1945
25 Ga0070662_100768108 3300005457 Unclassified 818
26 Ga0070662_101205509 3300005457 Unclassified 651
27 Ga0070681_10239585 3300005458 Bacteria 1728
28 Ga0068867_101939209 3300005459 Bacteria 556
29 Ga0070679_100185229 3300005530 Bacteria 2053
30 Ga0070684_101167974 3300005535 Bacteria 724
31 Ga0070672_100385851 3300005543 Bacteria 1199
32 Ga0070672_101324851 3300005543 Bacteria 643
33 Ga0070665_100077036 3300005548 Bacteria 3341
34 Ga0070665_100943667 3300005548 Bacteria 875
35 Ga0070665_102670327 3300005548 Bacteria 500
36 Ga0070664_100134966 3300005564 Bacteria 2169
37 Ga0068854_100339622 3300005578 Bacteria 1226
38 Ga0068864_100895370 3300005618 Bacteria 876
39 Ga0068861_100293873 3300005719 Bacteria 1404
40 Ga0068861_100498890 3300005719 Bacteria 1100
41 Ga0068870_10295577 3300005840 Bacteria 1021
42 Ga0068870_10608991 3300005840 Bacteria 743
43 Ga0081455_10016924 3300005937 Bacteria 7009
44 Ga0081455_10563003 3300005937 Unclassified 751
45 Ga0081538_10000039 3300005981 Bacteria 118810
46 Ga0081538_10000436 3300005981 Bacteria 47027
47 Ga0081538_10001416 3300005981 Bacteria 24648
48 Ga0081538_10001657 3300005981 Bacteria 22761
49 Ga0081538_10003559 3300005981 Bacteria 14657
50 Ga0081538_10007576 3300005981 Bacteria 9365
51 Ga0081538_10008330 3300005981 Bacteria 8825
52 Ga0081538_10029214 3300005981 Bacteria 3773
53 Ga0081538_10224897 3300005981 Unclassified 740
54 Ga0081540_1038813 3300005983 Bacteria 2504
55 Ga0070717_10494413 3300006028 Bacteria 1105
56 Ga0070712_100542277 3300006175 Bacteria 979
57 Ga0070712_101255224 3300006175 Bacteria 645
58 Ga0075428_100108004 3300006844 Bacteria 3033
59 Ga0075430_100290001 3300006846 Bacteria 1354
60 Ga0075431_100067744 3300006847 Bacteria 3685
61 Ga0075431_101333287 3300006847 Bacteria 678
62 Ga0075433_10022444 3300006852 Bacteria 5296
63 Ga0075434_100028835 3300006871 Bacteria 5458
64 Ga0075429_100426901 3300006880 Bacteria 1161
65 Ga0075429_100719733 3300006880 Bacteria 874
66 Ga0068865_100433626 3300006881 Bacteria 1083
67 Ga0075436_100085026 3300006914 Bacteria 2196
68 Ga0075435_100056649 3300007076 Bacteria 3169
69 Ga0111539_10008491 3300009094 Bacteria 13054
70 Ga0111539_10718217 3300009094 Bacteria 1163
71 Ga0105245_10496719 3300009098 Bacteria 1236
72 Ga0105245_11977642 3300009098 Bacteria 636
73 Ga0114129_10054812 3300009147 Bacteria 5589
74 Ga0114129_11970733 3300009147 Bacteria 707
75 Ga0114129_12514638 3300009147 Bacteria 615
76 Ga0105243_10855230 3300009148 Bacteria 901
77 Ga0105243_12036573 3300009148 Unclassified 609
78 Ga0105243_12324685 3300009148 Unclassified 574
79 Ga0105239_12452832 3300010375 Unclassified 608
80 Ga0105239_12770335 3300010375 Bacteria 572
81 Ga0105246_11376286 3300011119 Bacteria 657
82 Ga0157369_10560017 3300013105 Bacteria 1181
83 Ga0157372_11971373 3300013307 Bacteria 671
84 Ga0157375_11845004 3300013308 Bacteria 717
85 Ga0163163_10330102 3300014325 Bacteria 1580
86 Ga0157380_10852895 3300014326 Bacteria 933
87 Ga0157377_11002430 3300014745 Bacteria 632
88 Ga0157376_11233160 3300014969 Bacteria 777
89 Ga0157376_11525201 3300014969 Bacteria 702
90 Ga0206353_11048412 3300020082 Bacteria 612
91 Ga0207692_10808359 3300025898 Unclassified 613
92 Ga0207688_10335725 3300025901 Bacteria 929
93 Ga0207688_10454158 3300025901 Bacteria 799
94 Ga0207699_11401033 3300025906 Bacteria 517
95 Ga0207645_10196253 3300025907 Bacteria 1327
96 Ga0207645_11130235 3300025907 Bacteria 527
97 Ga0207643_10227636 3300025908 Bacteria 1143
98 Ga0207643_10753225 3300025908 Bacteria 630
99 Ga0207705_10989107 3300025909 Bacteria 650
100 Ga0207707_10289919 3300025912 Bacteria 1416
101 Ga0207693_10990523 3300025915 Bacteria 642
102 Ga0207660_10900463 3300025917 Bacteria 722
103 Ga0207649_10123465 3300025920 Bacteria 1749
104 Ga0207649_11423289 3300025920 Bacteria 549
105 Ga0207652_11306195 3300025921 Bacteria 628
106 Ga0207687_10565574 3300025927 Bacteria 955
107 Ga0207690_11288248 3300025932 Bacteria 611
108 Ga0207706_11125491 3300025933 Unclassified 655
109 Ga0207669_10414191 3300025937 Bacteria 1059
110 Ga0207669_10565494 3300025937 Bacteria 920
111 Ga0207704_11582145 3300025938 Bacteria 563
112 Ga0207704_11851333 3300025938 Bacteria 519
113 Ga0207689_10311523 3300025942 Bacteria 1305
114 Ga0207661_11479394 3300025944 Unclassified 623
115 Ga0207679_10164150 3300025945 Bacteria 1822
116 Ga0207640_11887950 3300025981 Unclassified 540
117 Ga0207639_12086202 3300026041 Bacteria 528
118 Ga0207678_10961376 3300026067 Bacteria 756
119 Ga0207708_10393010 3300026075 Bacteria 1145
120 Ga0207708_10451686 3300026075 Bacteria 1070
121 Ga0207708_11383247 3300026075 Bacteria 617
122 Ga0207648_10473669 3300026089 Bacteria 1143
123 Ga0207648_11036281 3300026089 Bacteria 769
124 Ga0207676_10714332 3300026095 Bacteria 972
125 Ga0207674_10662803 3300026116 Bacteria 1008
126 Ga0207674_11935457 3300026116 Bacteria 555
127 Ga0207675_100476033 3300026118 Bacteria 1240
128 Ga0207675_100796160 3300026118 Bacteria 958
129 Ga0207683_10599276 3300026121 Bacteria 1020
130 Ga0207698_11102338 3300026142 Bacteria 807
131 Ga0207698_11930688 3300026142 Bacteria 605
132 Ga0207428_10287566 3300027907 Bacteria 1219
133 Ga0268266_10144146 3300028379 Bacteria 2140
134 Ga0268266_11357058 3300028379 Bacteria 686
135 Ga0307405_10442775 3300031731 Bacteria 1028
136 Ga0307405_10892998 3300031731 Unclassified 751
137 Ga0307405_11040507 3300031731 Bacteria 701
138 Ga0307405_12065428 3300031731 Bacteria 511
139 Ga0307413_11839223 3300031824 Bacteria 543
140 Ga0307410_10925570 3300031852 Bacteria 748
141 Ga0307406_11166300 3300031901 Unclassified 668
142 Ga0307412_10184389 3300031911 Bacteria 1573
143 Ga0307412_12066886 3300031911 Bacteria 528
144 Ga0307409_100217065 3300031995 Bacteria 1724
145 Ga0307409_100972438 3300031995 Bacteria 866
146 Ga0307416_100217889 3300032002 Bacteria 1828
147 Ga0307416_103423312 3300032002 Bacteria 531
148 Ga0307411_11542891 3300032005 Bacteria 611
149 Ga0307415_100008804 3300032126 Bacteria 5618
150 Ga0307415_100957228 3300032126 Bacteria 793
151 Ga0307415_101094413 3300032126 Bacteria 746
152 Ga0395899_0549230 3300037312 Bacteria 743
153 Ga0395898_1035780 3300037466 Bacteria 756
154 Ga0436364_0283333 3300037853 Bacteria 4113
155 Ga0436363_1306470 3300039450 Bacteria 5382
156 Ga0436362_0895606 3300039453 Bacteria 1262
157 Ga0451853_2690245 3300041512 Bacteria 509
158 Ga0439435_0272491 3300042436 Bacteria 574
159 Ga0439464_0025508 3300042439 Bacteria 1637
160 Ga0439440_0054653 3300042993 Bacteria 1006
161 Ga0466961_0720849 3300044693 Bacteria 597
162 Ga0466964_0661366 3300044706 Unclassified 579
163 Ga0466967_0571648 3300045976 Bacteria 1114
164 Ga0495641_0081035 3300046461 Bacteria 1454
165 Ga0495630_1382513 3300046517 Unclassified 530
166 Ga0495652_0302970 3300046529 Bacteria 1161
167 Ga0495602_0175623 3300048088 Bacteria 1658
168 nmdc:mga05p37_151768_c1 3300050507 Bacteria 2833
169 nmdc:mga09592_664464_c1 3300050508 Bacteria 889
170 nmdc:mga0qj67_1522550_c1 3300050509 Bacteria 514
171 nmdc:mga0qj67_692159_c1 3300050509 Bacteria 811
172 nmdc:mga06r32_1278776_c1 3300050510 Bacteria 678
173 nmdc:mga06r32_348450_c1 3300050510 Bacteria 1466
174 nmdc:mga08y16_662737_c1 3300050511 Bacteria 1047
175 nmdc:mga0n895_228780_c1 3300050512 Bacteria 1888
176 nmdc:mga0rr50_30194_c1 3300050513 Bacteria 3834
177 nmdc:mga08x19_134668_c1 3300050514 Bacteria 1665
178 nmdc:mga0a205_388774_c1 3300050515 Bacteria 1260

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050509 nmdc:mga0qj67_692159_c1 nmdc:mga0qj67_692159_c1_35_289 76
2 3300014745 Ga0157377_11002430 Ga0157377_110024302 77
3 3300005328 Ga0070676_10245628 Ga0070676_102456282 78
4 3300005334 Ga0068869_100253335 Ga0068869_1002533353 78
5 3300005344 Ga0070661_100477648 Ga0070661_1004776481 78
6 3300005366 Ga0070659_101566844 Ga0070659_1015668442 78
7 3300005457 Ga0070662_100129295 Ga0070662_1001292952 78
8 3300005459 Ga0068867_101939209 Ga0068867_1019392091 78
9 3300005564 Ga0070664_100134966 Ga0070664_1001349662 78
10 3300005719 Ga0068861_100498890 Ga0068861_1004988902 78
11 3300011119 Ga0105246_11376286 Ga0105246_113762861 78
12 3300013308 Ga0157375_11845004 Ga0157375_118450041 78
13 3300014325 Ga0163163_10330102 Ga0163163_103301024 78
14 3300025907 Ga0207645_10196253 Ga0207645_101962532 78
15 3300025920 Ga0207649_10123465 Ga0207649_101234652 78
16 3300025932 Ga0207690_11288248 Ga0207690_112882481 78
17 3300025938 Ga0207704_11851333 Ga0207704_118513331 78
18 3300025942 Ga0207689_10311523 Ga0207689_103115232 78
19 3300025945 Ga0207679_10164150 Ga0207679_101641504 78
20 3300026041 Ga0207639_12086202 Ga0207639_120862022 78
21 3300026075 Ga0207708_10393010 Ga0207708_103930101 78
22 3300026089 Ga0207648_10473669 Ga0207648_104736692 78
23 3300026116 Ga0207674_11935457 Ga0207674_119354572 78
24 3300026118 Ga0207675_100476033 Ga0207675_1004760332 78
25 3300026121 Ga0207683_10599276 Ga0207683_105992761 78
26 3300026142 Ga0207698_11102338 Ga0207698_111023381 78
27 3300025906 Ga0207699_11401033 Ga0207699_114010332 82
28 3300045976 Ga0466967_0571648 Ga0466967_0571648_286_558 83
29 3300005457 Ga0070662_100768108 Ga0070662_1007681082 84
30 3300009147 Ga0114129_12514638 Ga0114129_125146382 84
31 3300044693 Ga0466961_0720849 Ga0466961_0720849_66_335 84
32 3300046517 Ga0495630_1382513 Ga0495630_1382513_46_306 84
33 3300044706 Ga0466964_0661366 Ga0466964_0661366_136_414 85
34 3300031731 Ga0307405_10442775 Ga0307405_104427752 86
35 3300031911 Ga0307412_10184389 Ga0307412_101843893 86
36 3300031995 Ga0307409_100217065 Ga0307409_1002170651 86
37 3300031995 Ga0307409_100972438 Ga0307409_1009724382 86
38 3300032002 Ga0307416_100217889 Ga0307416_1002178893 86
39 3300032002 Ga0307416_103423312 Ga0307416_1034233122 86
40 3300032005 Ga0307411_11542891 Ga0307411_115428912 86
41 3300032126 Ga0307415_100008804 Ga0307415_1000088043 86
42 3300032126 Ga0307415_100957228 Ga0307415_1009572281 86
43 3300005981 Ga0081538_10000039 Ga0081538_10000039119 87
44 3300031731 Ga0307405_10892998 Ga0307405_108929982 87
45 3300031731 Ga0307405_12065428 Ga0307405_120654281 87
46 3300037312 Ga0395899_0549230 Ga0395899_0549230_426_689 87
47 3300005327 Ga0070658_10113462 Ga0070658_101134621 88
48 3300005339 Ga0070660_100987403 Ga0070660_1009874032 88
49 3300005365 Ga0070688_101296365 Ga0070688_1012963652 88
50 3300005437 Ga0070710_10111736 Ga0070710_101117361 88
51 3300005455 Ga0070663_101694290 Ga0070663_1016942902 88
52 3300005543 Ga0070672_101324851 Ga0070672_1013248512 88
53 3300005548 Ga0070665_100943667 Ga0070665_1009436672 88
54 3300005548 Ga0070665_102670327 Ga0070665_1026703272 88
55 3300005618 Ga0068864_100895370 Ga0068864_1008953702 88
56 3300005840 Ga0068870_10608991 Ga0068870_106089912 88
57 3300005981 Ga0081538_10007576 Ga0081538_100075763 88
58 3300005981 Ga0081538_10224897 Ga0081538_102248972 88
59 3300005983 Ga0081540_1038813 Ga0081540_10388133 88
60 3300006028 Ga0070717_10494413 Ga0070717_104944133 88
61 3300006175 Ga0070712_100542277 Ga0070712_1005422772 88
62 3300006881 Ga0068865_100433626 Ga0068865_1004336262 88
63 3300009098 Ga0105245_11977642 Ga0105245_119776422 88
64 3300013307 Ga0157372_11971373 Ga0157372_119713732 88
65 3300014326 Ga0157380_10852895 Ga0157380_108528952 88
66 3300014969 Ga0157376_11233160 Ga0157376_112331601 88
67 3300025898 Ga0207692_10808359 Ga0207692_108083592 88
68 3300025908 Ga0207643_10753225 Ga0207643_107532252 88
69 3300025909 Ga0207705_10989107 Ga0207705_109891072 88
70 3300025938 Ga0207704_11582145 Ga0207704_115821452 88
71 3300026067 Ga0207678_10961376 Ga0207678_109613762 88
72 3300026089 Ga0207648_11036281 Ga0207648_110362812 88
73 3300026095 Ga0207676_10714332 Ga0207676_107143322 88
74 3300026116 Ga0207674_10662803 Ga0207674_106628032 88
75 3300028379 Ga0268266_11357058 Ga0268266_113570582 88
76 3300031731 Ga0307405_11040507 Ga0307405_110405072 88
77 3300032126 Ga0307415_101094413 Ga0307415_1010944132 88
78 3300041512 Ga0451853_2690245 Ga0451853_2690245_90_356 88
79 3300046529 Ga0495652_0302970 Ga0495652_0302970_746_1012 88
80 3300048088 Ga0495602_0175623 Ga0495602_0175623_457_723 88
81 3300003373 JGI25407J50210_10009659 JGI25407J50210_100096593 89
82 3300003373 JGI25407J50210_10026909 JGI25407J50210_100269092 89
83 3300005328 Ga0070676_11233065 Ga0070676_112330651 89
84 3300005328 Ga0070676_11296089 Ga0070676_112960892 89
85 3300005336 Ga0070680_100491395 Ga0070680_1004913952 89
86 3300005338 Ga0068868_102359035 Ga0068868_1023590351 89
87 3300005339 Ga0070660_100953217 Ga0070660_1009532172 89
88 3300005341 Ga0070691_10479818 Ga0070691_104798182 89
89 3300005345 Ga0070692_10945768 Ga0070692_109457681 89
90 3300005356 Ga0070674_100325285 Ga0070674_1003252852 89
91 3300005457 Ga0070662_101205509 Ga0070662_1012055092 89
92 3300005530 Ga0070679_100185229 Ga0070679_1001852294 89
93 3300005535 Ga0070684_101167974 Ga0070684_1011679741 89
94 3300005543 Ga0070672_100385851 Ga0070672_1003858512 89
95 3300005578 Ga0068854_100339622 Ga0068854_1003396223 89
96 3300005719 Ga0068861_100293873 Ga0068861_1002938732 89
97 3300005937 Ga0081455_10563003 Ga0081455_105630032 89
98 3300005981 Ga0081538_10001657 Ga0081538_1000165715 89
99 3300005981 Ga0081538_10008330 Ga0081538_1000833011 89
100 3300005981 Ga0081538_10029214 Ga0081538_100292143 89
101 3300006844 Ga0075428_100108004 Ga0075428_1001080042 89
102 3300006846 Ga0075430_100290001 Ga0075430_1002900012 89
103 3300006847 Ga0075431_100067744 Ga0075431_1000677444 89
104 3300006847 Ga0075431_101333287 Ga0075431_1013332872 89
105 3300006852 Ga0075433_10022444 Ga0075433_100224446 89
106 3300006871 Ga0075434_100028835 Ga0075434_1000288356 89
107 3300006880 Ga0075429_100426901 Ga0075429_1004269013 89
108 3300006880 Ga0075429_100719733 Ga0075429_1007197331 89
109 3300006914 Ga0075436_100085026 Ga0075436_1000850262 89
110 3300007076 Ga0075435_100056649 Ga0075435_1000566495 89
111 3300009094 Ga0111539_10008491 Ga0111539_100084915 89
112 3300009094 Ga0111539_10718217 Ga0111539_107182171 89
113 3300009147 Ga0114129_10054812 Ga0114129_100548122 89
114 3300009147 Ga0114129_11970733 Ga0114129_119707332 89
115 3300009148 Ga0105243_10855230 Ga0105243_108552302 89
116 3300009148 Ga0105243_12036573 Ga0105243_120365732 89
117 3300009148 Ga0105243_12324685 Ga0105243_123246851 89
118 3300010375 Ga0105239_12452832 Ga0105239_124528322 89
119 3300010375 Ga0105239_12770335 Ga0105239_127703351 89
120 3300013105 Ga0157369_10560017 Ga0157369_105600172 89
121 3300014969 Ga0157376_11525201 Ga0157376_115252012 89
122 3300020082 Ga0206353_11048412 Ga0206353_110484122 89
123 3300025901 Ga0207688_10335725 Ga0207688_103357251 89
124 3300025912 Ga0207707_10289919 Ga0207707_102899192 89
125 3300025917 Ga0207660_10900463 Ga0207660_109004631 89
126 3300025920 Ga0207649_11423289 Ga0207649_114232892 89
127 3300025921 Ga0207652_11306195 Ga0207652_113061952 89
128 3300025933 Ga0207706_11125491 Ga0207706_111254912 89
129 3300025937 Ga0207669_10414191 Ga0207669_104141912 89
130 3300025937 Ga0207669_10565494 Ga0207669_105654942 89
131 3300025981 Ga0207640_11887950 Ga0207640_118879502 89
132 3300026075 Ga0207708_10451686 Ga0207708_104516862 89
133 3300026075 Ga0207708_11383247 Ga0207708_113832471 89
134 3300026118 Ga0207675_100796160 Ga0207675_1007961602 89
135 3300026142 Ga0207698_11930688 Ga0207698_119306882 89
136 3300027907 Ga0207428_10287566 Ga0207428_102875662 89
137 3300031824 Ga0307413_11839223 Ga0307413_118392232 89
138 3300031852 Ga0307410_10925570 Ga0307410_109255702 89
139 3300031901 Ga0307406_11166300 Ga0307406_111663002 89
140 3300031911 Ga0307412_12066886 Ga0307412_120668861 89
141 3300037853 Ga0436364_0283333 Ga0436364_0283333_23_295 89
142 3300039450 Ga0436363_1306470 Ga0436363_1306470_3922_4194 89
143 3300039453 Ga0436362_0895606 Ga0436362_0895606_317_589 89
144 3300042436 Ga0439435_0272491 Ga0439435_0272491_168_437 89
145 3300042439 Ga0439464_0025508 Ga0439464_0025508_1052_1321 89
146 3300042993 Ga0439440_0054653 Ga0439440_0054653_461_730 89
147 3300046461 Ga0495641_0081035 Ga0495641_0081035_918_1190 89
148 3300050507 nmdc:mga05p37_151768_c1 nmdc:mga05p37_151768_c1_320_625 89
149 3300050508 nmdc:mga09592_664464_c1 nmdc:mga09592_664464_c1_56_361 89
150 3300050509 nmdc:mga0qj67_1522550_c1 nmdc:mga0qj67_1522550_c1_145_414 89
151 3300050510 nmdc:mga06r32_1278776_c1 nmdc:mga06r32_1278776_c1_357_626 89
152 3300050510 nmdc:mga06r32_348450_c1 nmdc:mga06r32_348450_c1_212_517 89
153 3300050511 nmdc:mga08y16_662737_c1 nmdc:mga08y16_662737_c1_651_956 89
154 3300050512 nmdc:mga0n895_228780_c1 nmdc:mga0n895_228780_c1_561_866 89
155 3300050513 nmdc:mga0rr50_30194_c1 nmdc:mga0rr50_30194_c1_2839_3144 89
156 3300050514 nmdc:mga08x19_134668_c1 nmdc:mga08x19_134668_c1_733_1038 89
157 3300050515 nmdc:mga0a205_388774_c1 nmdc:mga0a205_388774_c1_148_453 89
158 3300003373 JGI25407J50210_10004069 JGI25407J50210_100040693 90
159 3300005347 Ga0070668_100907124 Ga0070668_1009071241 90
160 3300005366 Ga0070659_102156620 Ga0070659_1021566202 90
161 3300005438 Ga0070701_10196146 Ga0070701_101961462 90
162 3300005458 Ga0070681_10239585 Ga0070681_102395851 90
163 3300005548 Ga0070665_100077036 Ga0070665_1000770365 90
164 3300005840 Ga0068870_10295577 Ga0068870_102955772 90
165 3300005937 Ga0081455_10016924 Ga0081455_100169244 90
166 3300005981 Ga0081538_10000436 Ga0081538_100004365 90
167 3300005981 Ga0081538_10001416 Ga0081538_1000141622 90
168 3300005981 Ga0081538_10003559 Ga0081538_100035599 90
169 3300006175 Ga0070712_101255224 Ga0070712_1012552242 90
170 3300009098 Ga0105245_10496719 Ga0105245_104967192 90
171 3300025901 Ga0207688_10454158 Ga0207688_104541582 90
172 3300025907 Ga0207645_11130235 Ga0207645_111302351 90
173 3300025908 Ga0207643_10227636 Ga0207643_102276362 90
174 3300025915 Ga0207693_10990523 Ga0207693_109905232 90
175 3300025927 Ga0207687_10565574 Ga0207687_105655742 90
176 3300025944 Ga0207661_11479394 Ga0207661_114793941 90
177 3300028379 Ga0268266_10144146 Ga0268266_101441462 90
178 3300037466 Ga0395898_1035780 Ga0395898_1035780_263_535 90

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13490

zf-HC2

Putative zinc-finger

19

53

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wur-assembly1.cif.gz_C crystal structure of sigw in complex with its anti-sigma rsiw, an oxdized form 0.756 17 81
5wuq-assembly2.cif.gz_D crystal structure of sigw in complex with its anti-sigma rsiw, a zinc binding form 0.7491 18 79
3hug-assembly6.cif.gz_F crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.7429 19 68
6in7-assembly1.cif.gz_A crystal structure of algu in complex with muca(cyto) 0.7091 14 82
5wur-assembly1.cif.gz_C crystal structure of sigw in complex with its anti-sigma rsiw, an oxdized form 0.698 17 81
ID Description Score Start End Superfamily
3hugF00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.7429 19 68 1.10.10.1320
3hugN00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.6762 17 79 1.10.10.1320
3hugP00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.6749 19 79 1.10.10.1320
2z2sD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.6687 21 80 1.10.10.1320
3hugF00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.6656 19 68 1.10.10.1320
ID Description Score Start End GO Terms
AF-A0A849RPG5-F1-model_v4 Putative zinc-finger domain-containing protein 0.8757 13 72
AF-A0A6L8DKW6-F1-model_v4 Methylated-DNA--[protein]-cysteine S-methyltransferase (EC 2.1.1.63) 0.8473 11 81 GO:0003677
GO:0003908
GO:0006281
GO:0006355
GO:0008270
GO:0032259
AF-A0A2E7PEW0-F1-model_v4 Putative zinc-finger domain-containing protein 0.8384 14 82
AF-X0VVL3-F1-model_v4 Putative zinc-finger domain-containing protein 0.8327 14 80 GO:0016020
AF-A0A7C5BRD2-F1-model_v4 Zf-HC2 domain-containing protein 0.8283 11 83

Feature Viewer

pLDDT pTM Quality
81.6 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map