F271732

General Info

Members Datasets Scaffolds Average Seq Length
178 128 356 736

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10006705|Ga0081455_100067056
Length 792
Sequence MSSETRVAYRTCPLCEAGCGLEIALHRTNGAERASATQRAPGPSGPSPEATGAEDTAXXXXRPGRRPRPGDYERVGRIRGDRDDVFSHGFICPKGSTLRQLHEDPDWLRGPLVKRDGSFEPASWDEAFAEVERRLLPIVEQRGRDAVGIYLGNPNAHSLGALIFLRPLVRALGTTNVFSASTVDQRPKEVSAGLMFGGALTVPVPDVDRTDFLLMLGANPYASNGSLATAPDWPGRIEALLERGGRLVVVDPRRTQTAEVASRHLPIRPGTDPLLLMALVNVLAADGLIDLGRLEPYVVGVDQVVRLAEPFTPEAVAPATGLDAEEIRALAHDLAAAPSACVYGRIGTTTAEFGSLTSWLVDVLNVLTGNLDRAGGAMFATAAAGAANTRGKPRYGRGIKLHRRHSRVRGLGETMGELPAACLAEEIDTPGEGQIRAMVVVGGNPVLSTPNAGRLDAALAGLDFMVAVDPYVNETTRHADVILPVPTALQRPHYDLALLQLAVRNVANYSPAVLPLDEGQPDEWHVLARLALVVQGFGADADPALVDDLVLRALVEGAVADETSPVAGREVDEVIALLGERTGPSRIIDFMLRTGPYGEGFGARPDGLSLDVLLDHPHGVDLGPLEPRLPDVLRTPSGMVELAPEPLTADVGRLRAAMAEPGGGMRLIGRRDLRSNNSWMHNVEVLVKGRPRCTLHVHPDDASRLGLVDGEPASVRSRAGTITIPAEVTDAIRPGVVSIPHGWGHDLPGVELSVARRYAGVNSNLLADEVLVDPVSGNAVLNGIPVEVAPAG

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
41 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
42 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
43 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
50 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
52 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
53 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
54 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
55 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
56 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
57 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
58 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
59 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
60 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
63 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
64 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
65 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
66 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
67 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
68 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
69 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
70 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
71 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
72 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
73 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
74 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
75 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
76 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
77 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
78 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
81 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
82 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
83 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
84 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
85 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
86 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
87 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
88 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
89 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
90 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
91 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
92 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
93 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
103 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
104 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
105 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
106 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
107 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
108 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
109 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
110 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
111 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
112 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
113 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
114 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
115 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
116 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
117 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
118 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
119 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
120 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
121 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
122 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
123 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
124 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
125 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
126 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
127 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
128 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.75
Metatranscriptomes 0
Isolates 2.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.99
Nodule 0
Rhizoplane 5.06
Rhizosphere 75.84
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10006705 3300005937 Bacteria 12303
2 JGI25155J39150_1000071 3300002704 Bacteria 64384
3 JGI25156J39149_1000071 3300002705 Bacteria 80446
4 JGI25156J39149_1000097 3300002705 Bacteria 64372
5 JGI25154J39366_1000093 3300002738 Bacteria 80476
6 JGI25157J39369_1000088 3300002741 Bacteria 80446
7 JGI25159J45721_1002471 3300002987 Bacteria 7006
8 JGI25407J50210_10002122 3300003373 Bacteria 4631
9 Ga0070709_10009139 3300005434 Bacteria 5454
10 Ga0070714_100005457 3300005435 Bacteria 9708
11 Ga0070710_10002090 3300005437 Bacteria 9466
12 Ga0070681_10028709 3300005458 Bacteria 5592
13 Ga0070706_100038438 3300005467 Bacteria 4416
14 Ga0070698_100019206 3300005471 Bacteria 7181
15 Ga0070695_100005571 3300005545 Bacteria 7416
16 Ga0068861_100018712 3300005719 Bacteria 4937
17 Ga0068860_100001187 3300005843 Bacteria 28493
18 Ga0068862_100030197 3300005844 Bacteria 4567
19 Ga0081455_10004589 3300005937 Bacteria 15427
20 Ga0081455_10009686 3300005937 Bacteria 9881
21 Ga0081455_10043589 3300005937 Bacteria 3923
22 Ga0081538_10000159 3300005981 Bacteria 71002
23 Ga0081538_10000915 3300005981 Bacteria 31814
24 Ga0081538_10002282 3300005981 Bacteria 18948
25 Ga0081538_10004559 3300005981 Bacteria 12752
26 Ga0081540_1004367 3300005983 Bacteria 10808
27 Ga0081539_10036946 3300005985 Bacteria 2915
28 Ga0075368_10009386 3300006042 Bacteria 3519
29 Ga0075363_100002506 3300006048 Bacteria 7522
30 Ga0075363_100004594 3300006048 Bacteria 6058
31 Ga0075363_100005213 3300006048 Bacteria 5757
32 Ga0075364_10011958 3300006051 Bacteria 5290
33 Ga0075362_10001756 3300006177 Bacteria 7054
34 Ga0075367_10016539 3300006178 Bacteria 4029
35 Ga0075370_10004300 3300006353 Bacteria 6898
36 Ga0075428_100000162 3300006844 Bacteria 61167
37 Ga0075428_100004474 3300006844 Bacteria 15427
38 Ga0075428_100010420 3300006844 Bacteria 10321
39 Ga0075428_100031271 3300006844 Bacteria 5886
40 Ga0075428_100044817 3300006844 Bacteria 4860
41 Ga0075428_100058309 3300006844 Bacteria 4227
42 Ga0075428_100060701 3300006844 Bacteria 4141
43 Ga0075430_100076266 3300006846 Bacteria 2810
44 Ga0075431_100007483 3300006847 Bacteria 10874
45 Ga0075431_100039584 3300006847 Bacteria 4856
46 Ga0075431_100062577 3300006847 Bacteria 3839
47 Ga0075431_100078599 3300006847 Bacteria 3405
48 Ga0075433_10015324 3300006852 Bacteria 6283
49 Ga0075434_100003207 3300006871 Bacteria 14592
50 Ga0075429_100012262 3300006880 Bacteria 7434
51 Ga0105240_10096513 3300009093 Unclassified 3602
52 Ga0111539_10011467 3300009094 Bacteria 11123
53 Ga0111539_10028048 3300009094 Bacteria 6874
54 Ga0111539_10030728 3300009094 Bacteria 6530
55 Ga0111539_10107287 3300009094 Bacteria 3277
56 Ga0105245_10006257 3300009098 Bacteria 10473
57 Ga0114129_10001284 3300009147 Bacteria 33454
58 Ga0114129_10004241 3300009147 Bacteria 20249
59 Ga0105237_10071999 3300009545 Unclassified 3450
60 Ga0157379_10000377 3300014968 Bacteria 36018
61 Ga0163161_10005235 3300017792 Bacteria 9024
62 Ga0209435_100014 3300025206 Bacteria 322129
63 Ga0209646_1000001 3300025246 Bacteria 3092932
64 Ga0209026_1000073 3300025250 Bacteria 205399
65 Ga0209759_1000013 3300025256 Bacteria 399300
66 Ga0207707_10016354 3300025912 Bacteria 6471
67 Ga0207707_10023203 3300025912 Bacteria 5429
68 Ga0207694_10005049 3300025924 Bacteria 10209
69 Ga0207664_10018944 3300025929 Bacteria 5077
70 Ga0207667_10025085 3300025949 Bacteria 6535
71 Ga0207702_10061161 3300026078 Bacteria 3212
72 Ga0207428_10068477 3300027907 Bacteria 2791
73 Ga0268266_10065620 3300028379 Bacteria 3138
74 Ga0307515_10002073 3300028794 Bacteria 44150
75 Ga0307515_10017757 3300028794 Bacteria 12938
76 Ga0265338_10003762 3300028800 Bacteria 21078
77 Ga0265320_10020843 3300031240 Bacteria 3541
78 Ga0265339_10000902 3300031249 Bacteria 22811
79 Ga0307508_10003366 3300031616 Bacteria 16209
80 Ga0307508_10050649 3300031616 Bacteria 3694
81 Ga0316576_10004265 3300031727 Bacteria 8545
82 Ga0307516_10006181 3300031730 Bacteria 14094
83 Ga0307410_10027113 3300031852 Bacteria 3617
84 Ga0307407_10006678 3300031903 Bacteria 5157
85 Ga0307412_10031770 3300031911 Bacteria 3338
86 Ga0307409_100004854 3300031995 Bacteria 7637
87 Ga0307411_10027946 3300032005 Bacteria 3422
88 Ga0373942_0000175 3300035207 Bacteria 15984
89 Ga0373962_0000405 3300035242 Bacteria 9433
90 Ga0373947_0006307 3300035725 Bacteria 6892
91 Ga0373947_0025427 3300035725 Bacteria 3454
92 Ga0400489_32109 3300039093 Bacteria 5226
93 Ga0436365_1678776 3300039437 Bacteria 4576
94 Ga0439449_0010700 3300042007 Bacteria 3466
95 Ga0439464_0001102 3300042439 Bacteria 6215
96 Ga0451577_0000714 3300042876 Bacteria 51609
97 Ga0466972_0000651 3300044658 Bacteria 16742
98 Ga0466965_0000134 3300044683 Bacteria 21100
99 Ga0466963_0009755 3300044694 Bacteria 5791
100 Ga0466971_0004409 3300044719 Bacteria 6074
101 Ga0466971_0005552 3300044719 Bacteria 5479
102 Ga0466957_0023429 3300044842 Bacteria 3650
103 Ga0466957_0046735 3300044842 Bacteria 2629
104 Ga0466959_0005215 3300045049 Bacteria 8867
105 Ga0466959_0011661 3300045049 Bacteria 6321
106 Ga0451576_0029329 3300045051 Bacteria 5888
107 Ga0466958_0013147 3300045836 Bacteria 4707
108 Ga0466958_0040941 3300045836 Bacteria 2785
109 Ga0466967_0062320 3300045976 Bacteria 3310
110 Ga0495580_0007667 3300046472 Bacteria 8656
111 Ga0495630_0027145 3300046517 Bacteria 4245
112 Ga0495613_0016185 3300046689 Bacteria 5555
113 Ga0495672_0003585 3300047320 Bacteria 13196
114 Ga0496101_0042940 3300048904 Bacteria 3229
115 Ga0496102_0000088 3300048905 Bacteria 129762
116 Ga0496102_0015053 3300048905 Bacteria 6733
117 Ga0496103_0003066 3300048906 Bacteria 10276
118 Ga0496108_0015191 3300048911 Bacteria 6282
119 Ga0496109_0045364 3300048912 Bacteria 3988
120 Ga0496110_0012795 3300048913 Bacteria 6911
121 Ga0496112_0029050 3300048915 Bacteria 5345
122 Ga0496114_0059956 3300048917 Bacteria 3180
123 Ga0496126_0016854 3300048929 Bacteria 7293
124 Ga0501033_0045950 3300049570 Bacteria 3248
125 Ga0501034_0001912 3300049571 Bacteria 26339
126 Ga0501034_0008739 3300049571 Bacteria 10664
127 Ga0501034_0028572 3300049571 Bacteria 5676
128 Ga0501038_0062939 3300049574 Bacteria 3169
129 Ga0501039_0015481 3300049575 Bacteria 5839
130 Ga0501040_0003964 3300049576 Bacteria 9618
131 Ga0501041_0004304 3300049577 Bacteria 8238
132 Ga0501042_0017116 3300049578 Bacteria 4994
133 Ga0501042_0040665 3300049578 Bacteria 3305
134 Ga0501046_0002806 3300049580 Bacteria 16227
135 Ga0501048_0044399 3300049582 Bacteria 3178
136 Ga0501067_0029597 3300049583 Bacteria 3035
137 Ga0501068_0009327 3300049584 Bacteria 5486
138 Ga0501068_0029098 3300049584 Bacteria 3271
139 Ga0501071_0053938 3300049587 Bacteria 2900
140 Ga0501072_0006245 3300049588 Bacteria 9081
141 Ga0501072_0036812 3300049588 Bacteria 3837
142 Ga0501075_0020633 3300049591 Bacteria 4795
143 Ga0501075_0039274 3300049591 Bacteria 3543
144 Ga0501076_0032414 3300049592 Bacteria 4078
145 Ga0501076_0048222 3300049592 Bacteria 3367
146 Ga0501079_0037950 3300049741 Bacteria 3715
147 Ga0501080_0072467 3300049742 Bacteria 3205
148 Ga0501045_0009965 3300049824 Bacteria 6647
149 Ga0501045_0026589 3300049824 Bacteria 4165
150 nmdc:mga03n38_1180_c1 3300050490 Bacteria 7285
151 nmdc:mga00v17_17466_c1 3300050491 Bacteria 4063
152 nmdc:mga00v17_3010_c1 3300050491 Bacteria 8660
153 nmdc:mga05p37_2139_c1 3300050507 Bacteria 23071
154 nmdc:mga05p37_5058_c1 3300050507 Bacteria 15459
155 nmdc:mga05p37_78401_c1 3300050507 Bacteria 4068
156 nmdc:mga05p37_8057_c1 3300050507 Bacteria 12446
157 nmdc:mga09592_81472_c1 3300050508 Bacteria 2758
158 nmdc:mga0qj67_14515_c1 3300050509 Bacteria 5958
159 nmdc:mga0qj67_20064_c1 3300050509 Bacteria 5114
160 nmdc:mga0qj67_8581_c1 3300050509 Bacteria 7582
161 nmdc:mga06r32_2446_c1 3300050510 Bacteria 16613
162 nmdc:mga06r32_2766_c1 3300050510 Bacteria 15698
163 nmdc:mga06r32_34176_c1 3300050510 Bacteria 4794
164 nmdc:mga06r32_87159_c1 3300050510 Bacteria 3046
165 nmdc:mga08y16_20256_c1 3300050511 Bacteria 7020
166 nmdc:mga0n895_22452_c1 3300050512 Bacteria 5917
167 Ga0500644_0000047 3300053088 Bacteria 73844
168 Ga0500616_0001394 3300053153 Bacteria 23294
169 Ga0500627_0007885 3300053158 Bacteria 3744
170 Ga0500645_000004 3300053730 Bacteria 305014
171 Ga0501084_0007256 3300054114 Bacteria 9134
172 Ga0501084_0051679 3300054114 Bacteria 3440
173 Ga0530510_0018213 3300061734 Bacteria 4979
174 Ga0530510_0019694 3300061734 Bacteria 4791
175 2511244180 2511231002 Bacteria 5042903
176 2753074865 2751185734 Bacteria 8863695
177 2870726047 2870721527 Bacteria 9689237
178 8047717248 8047710418 Bacteria 11023148
179 Ga0081455_10006705
180 JGI25155J39150_1000071
181 JGI25156J39149_1000071
182 JGI25156J39149_1000097
183 JGI25154J39366_1000093
184 JGI25157J39369_1000088
185 JGI25159J45721_1002471
186 JGI25407J50210_10002122
187 Ga0070709_10009139
188 Ga0070714_100005457
189 Ga0070710_10002090
190 Ga0070681_10028709
191 Ga0070706_100038438
192 Ga0070698_100019206
193 Ga0070695_100005571
194 Ga0068861_100018712
195 Ga0068860_100001187
196 Ga0068862_100030197
197 Ga0081455_10004589
198 Ga0081455_10009686
199 Ga0081455_10043589
200 Ga0081538_10000159
201 Ga0081538_10000915
202 Ga0081538_10002282
203 Ga0081538_10004559
204 Ga0081540_1004367
205 Ga0081539_10036946
206 Ga0075368_10009386
207 Ga0075363_100002506
208 Ga0075363_100004594
209 Ga0075363_100005213
210 Ga0075364_10011958
211 Ga0075362_10001756
212 Ga0075367_10016539
213 Ga0075370_10004300
214 Ga0075428_100000162
215 Ga0075428_100004474
216 Ga0075428_100010420
217 Ga0075428_100031271
218 Ga0075428_100044817
219 Ga0075428_100058309
220 Ga0075428_100060701
221 Ga0075430_100076266
222 Ga0075431_100007483
223 Ga0075431_100039584
224 Ga0075431_100062577
225 Ga0075431_100078599
226 Ga0075433_10015324
227 Ga0075434_100003207
228 Ga0075429_100012262
229 Ga0105240_10096513
230 Ga0111539_10011467
231 Ga0111539_10028048
232 Ga0111539_10030728
233 Ga0111539_10107287
234 Ga0105245_10006257
235 Ga0114129_10001284
236 Ga0114129_10004241
237 Ga0105237_10071999
238 Ga0157379_10000377
239 Ga0163161_10005235
240 Ga0209435_100014
241 Ga0209646_1000001
242 Ga0209026_1000073
243 Ga0209759_1000013
244 Ga0207707_10016354
245 Ga0207707_10023203
246 Ga0207694_10005049
247 Ga0207664_10018944
248 Ga0207667_10025085
249 Ga0207702_10061161
250 Ga0207428_10068477
251 Ga0268266_10065620
252 Ga0307515_10002073
253 Ga0307515_10017757
254 Ga0265338_10003762
255 Ga0265320_10020843
256 Ga0265339_10000902
257 Ga0307508_10003366
258 Ga0307508_10050649
259 Ga0316576_10004265
260 Ga0307516_10006181
261 Ga0307410_10027113
262 Ga0307407_10006678
263 Ga0307412_10031770
264 Ga0307409_100004854
265 Ga0307411_10027946
266 Ga0373942_0000175
267 Ga0373962_0000405
268 Ga0373947_0006307
269 Ga0373947_0025427
270 Ga0400489_32109
271 Ga0436365_1678776
272 Ga0439449_0010700
273 Ga0439464_0001102
274 Ga0451577_0000714
275 Ga0466972_0000651
276 Ga0466965_0000134
277 Ga0466963_0009755
278 Ga0466971_0004409
279 Ga0466971_0005552
280 Ga0466957_0023429
281 Ga0466957_0046735
282 Ga0466959_0005215
283 Ga0466959_0011661
284 Ga0451576_0029329
285 Ga0466958_0013147
286 Ga0466958_0040941
287 Ga0466967_0062320
288 Ga0495580_0007667
289 Ga0495630_0027145
290 Ga0495613_0016185
291 Ga0495672_0003585
292 Ga0496101_0042940
293 Ga0496102_0000088
294 Ga0496102_0015053
295 Ga0496103_0003066
296 Ga0496108_0015191
297 Ga0496109_0045364
298 Ga0496110_0012795
299 Ga0496112_0029050
300 Ga0496114_0059956
301 Ga0496126_0016854
302 Ga0501033_0045950
303 Ga0501034_0001912
304 Ga0501034_0008739
305 Ga0501034_0028572
306 Ga0501038_0062939
307 Ga0501039_0015481
308 Ga0501040_0003964
309 Ga0501041_0004304
310 Ga0501042_0017116
311 Ga0501042_0040665
312 Ga0501046_0002806
313 Ga0501048_0044399
314 Ga0501067_0029597
315 Ga0501068_0009327
316 Ga0501068_0029098
317 Ga0501071_0053938
318 Ga0501072_0006245
319 Ga0501072_0036812
320 Ga0501075_0020633
321 Ga0501075_0039274
322 Ga0501076_0032414
323 Ga0501076_0048222
324 Ga0501079_0037950
325 Ga0501080_0072467
326 Ga0501045_0009965
327 Ga0501045_0026589
328 nmdc:mga03n38_1180_c1
329 nmdc:mga00v17_17466_c1
330 nmdc:mga00v17_3010_c1
331 nmdc:mga05p37_2139_c1
332 nmdc:mga05p37_5058_c1
333 nmdc:mga05p37_78401_c1
334 nmdc:mga05p37_8057_c1
335 nmdc:mga09592_81472_c1
336 nmdc:mga0qj67_14515_c1
337 nmdc:mga0qj67_20064_c1
338 nmdc:mga0qj67_8581_c1
339 nmdc:mga06r32_2446_c1
340 nmdc:mga06r32_2766_c1
341 nmdc:mga06r32_34176_c1
342 nmdc:mga06r32_87159_c1
343 nmdc:mga08y16_20256_c1
344 nmdc:mga0n895_22452_c1
345 Ga0500644_0000047
346 Ga0500616_0001394
347 Ga0500627_0007885
348 Ga0500645_000004
349 Ga0501084_0007256
350 Ga0501084_0051679
351 Ga0530510_0018213
352 Ga0530510_0019694
353 2511244180
354 2753074865
355 2870726047
356 8047717248

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01568

Molydop_binding

Molydopterin dinucleotide binding domain

665

785

0.93

PF00384

Molybdopterin

Molybdopterin oxidoreductase

108

489

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dyi-assembly2.cif.gz_H structure of p97 n-d1 wild-type in complex with adp 0.9164 616 666
8hrz-assembly1.cif.gz_D crystal structure of the p97-n/d1 hexamer in complex with six p47-ubx domains 0.9043 615 667
8fct-assembly1.cif.gz_F cryo-em structure of p97:ubxd1 lariat mutant 0.8934 615 667
3tiw-assembly1.cif.gz_A crystal structure of p97n in complex with the c-terminus of gp78 0.8891 615 667
7dww-assembly2.cif.gz_A crystal structure of the computationally designed msdpbb_sym2 protein 0.888 617 667
ID Description Score Start End Superfamily
2v45A01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;ADC-like domains 0.8795 16 67 2.20.25.90
2vpzE01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;ADC-like domains 0.8548 10 70 2.20.25.90
af_L0T2Z1_2_58_2.20.25.90 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;ADC-like domains 0.8463 9 63 2.20.25.90
af_P9WIV9_711_804_2.40.40.20 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.8294 608 667 2.40.40.20
1kqgA03 Alpha Beta;3-Layer(aba) Sandwich;Dimethylsulfoxide Reductase; domain 2;Dimethylsulfoxide Reductase, domain 2 0.8278 145 314 3.40.228.10
ID Description Score Start End GO Terms
AF-A0A2S8NBV8-F1-model_v4 deleted 0.9846 344 426
AF-A0A7K0VSG4-F1-model_v4 Molybdopterin-dependent oxidoreductase 0.9789 10 469 GO:0016020
GO:0016491
GO:0046872
GO:0051539
AF-A0A5C9CJ59-F1-model_v4 Molybdopterin oxidoreductase 0.9777 11 497 GO:0016491
GO:0046872
GO:0051539
AF-A0A2S9FMK2-F1-model_v4 Molybdopterin dinucleotide-binding protein 0.9662 334 468 GO:0016491
AF-A0A7J5EGH4-F1-model_v4 Molybdopterin-dependent oxidoreductase 0.9651 11 275 GO:0016491
GO:0046872
GO:0051539

Map