F271454

General Info

Members Datasets Scaffolds Average Seq Length
178 104 356 227

Family's Representative Sequence

Representative Sequence 3300005343|Ga0070687_100293337|Ga0070687_1002933372
Length 232
Sequence VTDDIHSLPRPQAVLFDLDGTLVDTVGTRIDAWTEALEAAGYTTTRDQLAPMIGLDGRRLAKEVATLAGRPIDEARSEEIDKASGEIYERLNEPRPLPGVAAVVAAIEAAGIKWAIATSSRKDQVKTSVDKLGLSGEPAIIDASHVEHAKPEPDLLLYAAKELGVDPGRCWYVGDSTWDMVSAVAAGMVAIGVTAGSAVGGDALRSAGAAVVVGTLEDIAEAIGQPASERAT

Samples

Sample ID Description Type Environment
1 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
57 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
58 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
59 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
60 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
61 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
62 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
63 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
64 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
65 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
66 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
67 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
68 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
69 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
70 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
71 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
72 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
84 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
85 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
86 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
87 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
88 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
89 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
90 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
91 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
92 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
93 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
94 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
95 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
97 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
98 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
99 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
100 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
101 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
102 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
103 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
104 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.74
Rhizosphere 93.26
Stem 0
Stem Tuber 0
Unclassified 10.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070687_100293337 3300005343 Unclassified 1029
2 Ga0068869_100364358 3300005334 Bacteria 1181
3 Ga0070687_100023002 3300005343 Bacteria 2956
4 Ga0070661_100680100 3300005344 Bacteria 837
5 Ga0070669_100040467 3300005353 Bacteria 3388
6 Ga0070675_100408154 3300005354 Bacteria 1213
7 Ga0070705_100189704 3300005440 Bacteria 1400
8 Ga0070705_100243082 3300005440 Bacteria 1259
9 Ga0070708_100004742 3300005445 Bacteria 10710
10 Ga0070708_101118067 3300005445 Bacteria 738
11 Ga0070662_100240220 3300005457 Bacteria 1452
12 Ga0070681_10030254 3300005458 Bacteria 5432
13 Ga0070681_10872378 3300005458 Bacteria 818
14 Ga0070706_100000868 3300005467 Bacteria 33231
15 Ga0070706_100098855 3300005467 Bacteria 2711
16 Ga0070707_100036366 3300005468 Bacteria 4698
17 Ga0070707_100180091 3300005468 Bacteria 2060
18 Ga0070698_100110338 3300005471 Bacteria 2716
19 Ga0070698_100183572 3300005471 Bacteria 2030
20 Ga0070698_100186441 3300005471 Unclassified 2012
21 Ga0070698_100398549 3300005471 Bacteria 1309
22 Ga0070698_100545558 3300005471 Bacteria 1099
23 Ga0070699_100000071 3300005518 Bacteria 96895
24 Ga0070699_100029002 3300005518 Bacteria 4771
25 Ga0070699_100114656 3300005518 Bacteria 2367
26 Ga0070699_100203514 3300005518 Bacteria 1761
27 Ga0070684_100069178 3300005535 Bacteria 3105
28 Ga0070684_100075100 3300005535 Bacteria 2981
29 Ga0070686_100040380 3300005544 Bacteria 2911
30 Ga0070696_100006988 3300005546 Bacteria 7530
31 Ga0070693_100202826 3300005547 Bacteria 1289
32 Ga0070704_100102763 3300005549 Bacteria 2157
33 Ga0070664_100425566 3300005564 Bacteria 1217
34 Ga0068857_100187407 3300005577 Bacteria 1884
35 Ga0068854_100674431 3300005578 Bacteria 890
36 Ga0070702_100226266 3300005615 Unclassified 1254
37 Ga0070702_100298073 3300005615 Bacteria 1114
38 Ga0068870_10221202 3300005840 Bacteria 1159
39 Ga0068863_100760324 3300005841 Bacteria 965
40 Ga0068858_100686922 3300005842 Bacteria 996
41 Ga0068862_100518151 3300005844 Bacteria 1134
42 Ga0081539_10049826 3300005985 Unclassified 2374
43 Ga0075433_10070657 3300006852 Bacteria 3069
44 Ga0075434_100045657 3300006871 Bacteria 4346
45 Ga0075434_100370934 3300006871 Bacteria 1452
46 Ga0075434_100598386 3300006871 Unclassified 1122
47 Ga0075435_100195887 3300007076 Unclassified 1711
48 Ga0099794_10003715 3300007265 Bacteria 5873
49 Ga0105245_10035959 3300009098 Bacteria 4397
50 Ga0105245_10039282 3300009098 Bacteria 4213
51 Ga0105245_10104465 3300009098 Bacteria 2626
52 Ga0114129_10023649 3300009147 Bacteria 8709
53 Ga0114129_10125446 3300009147 Bacteria 3530
54 Ga0114129_11460053 3300009147 Bacteria 842
55 Ga0105242_10037230 3300009176 Bacteria 3907
56 Ga0105242_10619004 3300009176 Bacteria 1048
57 Ga0105246_10036223 3300011119 Bacteria 3304
58 Ga0105246_10260723 3300011119 Bacteria 1381
59 Ga0157378_10723891 3300013297 Bacteria 1016
60 Ga0157375_10272479 3300013308 Unclassified 1855
61 Ga0157375_10556949 3300013308 Bacteria 1308
62 Ga0163163_10276914 3300014325 Bacteria 1729
63 Ga0157380_10039516 3300014326 Bacteria 3670
64 Ga0182008_10269158 3300014497 Bacteria 883
65 Ga0157377_10306681 3300014745 Bacteria 1050
66 Ga0157379_10228986 3300014968 Bacteria 1684
67 Ga0157376_10746132 3300014969 Bacteria 988
68 Ga0207688_10038742 3300025901 Bacteria 2646
69 Ga0207643_10266548 3300025908 Bacteria 1059
70 Ga0207684_10000003 3300025910 Bacteria 766933
71 Ga0207684_10062770 3300025910 Bacteria 3154
72 Ga0207649_10586976 3300025920 Bacteria 856
73 Ga0207646_10107195 3300025922 Bacteria 2506
74 Ga0207646_10274532 3300025922 Bacteria 1524
75 Ga0207687_10159165 3300025927 Bacteria 1731
76 Ga0207687_10227829 3300025927 Bacteria 1471
77 Ga0207687_10329189 3300025927 Bacteria 1239
78 Ga0207686_10500205 3300025934 Bacteria 943
79 Ga0207679_10400924 3300025945 Bacteria 1207
80 Ga0207677_10218814 3300026023 Bacteria 1526
81 Ga0207641_10642492 3300026088 Bacteria 1042
82 Ga0207674_10266646 3300026116 Bacteria 1660
83 Ga0207674_10304486 3300026116 Unclassified 1543
84 Ga0209588_1003065 3300027671 Unclassified 4606
85 Ga0207428_10018020 3300027907 Bacteria 6047
86 Ga0307405_10337000 3300031731 Bacteria 1158
87 Ga0307416_100007918 3300032002 Bacteria 6804
88 Ga0307416_100316639 3300032002 Bacteria 1560
89 Ga0307415_100114184 3300032126 Bacteria 2010
90 Ga0307415_100163324 3300032126 Bacteria 1729
91 Ga0373940_0056078 3300035088 Unclassified 1117
92 Ga0450920_011997 3300042122 Bacteria 1621
93 Ga0495603_0095836 3300046455 Bacteria 1734
94 Ga0495644_0067981 3300046523 Bacteria 1339
95 Ga0495587_0065642 3300046536 Bacteria 2119
96 Ga0496102_0275523 3300048905 Bacteria 1586
97 Ga0496105_0012781 3300048908 Bacteria 6651
98 Ga0496108_0002585 3300048911 Bacteria 14506
99 Ga0496108_0007680 3300048911 Bacteria 8735
100 Ga0496109_0003307 3300048912 Bacteria 13460
101 Ga0496109_0007614 3300048912 Bacteria 9183
102 Ga0496109_0053375 3300048912 Bacteria 3686
103 Ga0496110_0001402 3300048913 Bacteria 17420
104 Ga0496112_0000005 3300048915 Bacteria 525541
105 Ga0496112_0291410 3300048915 Bacteria 1578
106 Ga0496112_0795637 3300048915 Bacteria 870
107 Ga0496113_0006630 3300048916 Bacteria 7361
108 Ga0501031_0438855 3300049568 Unclassified 843
109 Ga0501033_0162227 3300049570 Bacteria 1609
110 Ga0501036_0020612 3300049572 Bacteria 5538
111 Ga0501036_0156101 3300049572 Bacteria 1924
112 Ga0501036_0333944 3300049572 Unclassified 1266
113 Ga0501036_0553609 3300049572 Bacteria 956
114 Ga0501037_0085069 3300049573 Bacteria 2290
115 Ga0501038_0016916 3300049574 Bacteria 6600
116 Ga0501038_0207150 3300049574 Bacteria 1571
117 Ga0501039_0009531 3300049575 Bacteria 7400
118 Ga0501039_0048197 3300049575 Bacteria 3293
119 Ga0501039_0096862 3300049575 Bacteria 2300
120 Ga0501040_0016481 3300049576 Bacteria 4893
121 Ga0501040_0025915 3300049576 Bacteria 3944
122 Ga0501040_0327519 3300049576 Bacteria 1096
123 Ga0501041_0013029 3300049577 Bacteria 4926
124 Ga0501042_0003349 3300049578 Bacteria 10047
125 Ga0501042_0050399 3300049578 Bacteria 2969
126 Ga0501042_0088934 3300049578 Bacteria 2216
127 Ga0501043_0070471 3300049579 Unclassified 2746
128 Ga0501048_0018342 3300049582 Bacteria 5148
129 Ga0501048_0056197 3300049582 Bacteria 2793
130 Ga0501048_0159606 3300049582 Bacteria 1595
131 Ga0501048_0288735 3300049582 Bacteria 1166
132 Ga0501067_0018273 3300049583 Bacteria 3884
133 Ga0501068_0003341 3300049584 Bacteria 8610
134 Ga0501068_0014683 3300049584 Bacteria 4481
135 Ga0501068_0339569 3300049584 Bacteria 964
136 Ga0501068_0342140 3300049584 Bacteria 961
137 Ga0501069_0029904 3300049585 Bacteria 2990
138 Ga0501069_0191024 3300049585 Unclassified 1185
139 Ga0501069_0308466 3300049585 Unclassified 929
140 Ga0501070_0029940 3300049586 Bacteria 4561
141 Ga0501071_0094559 3300049587 Bacteria 2198
142 Ga0501071_0413857 3300049587 Bacteria 1030
143 Ga0501072_0040289 3300049588 Bacteria 3668
144 Ga0501072_0595399 3300049588 Bacteria 872
145 Ga0501075_0035675 3300049591 Bacteria 3709
146 Ga0501075_0037116 3300049591 Bacteria 3639
147 Ga0501075_0096317 3300049591 Bacteria 2246
148 Ga0501075_0323409 3300049591 Bacteria 1175
149 Ga0501076_0012234 3300049592 Bacteria 6415
150 Ga0501076_0039936 3300049592 Bacteria 3685
151 Ga0501076_0084194 3300049592 Bacteria 2554
152 Ga0501079_0006605 3300049741 Bacteria 8728
153 Ga0501079_0307249 3300049741 Bacteria 1241
154 Ga0501080_0042785 3300049742 Bacteria 4217
155 Ga0501080_0114875 3300049742 Bacteria 2496
156 Ga0501081_0265222 3300049743 Bacteria 1255
157 Ga0501081_0662372 3300049743 Bacteria 783
158 Ga0501083_0089214 3300049744 Bacteria 2038
159 Ga0501083_0161451 3300049744 Bacteria 1466
160 Ga0501035_0123760 3300049822 Unclassified 2259
161 Ga0501045_0216454 3300049824 Unclassified 1426
162 nmdc:mga05p37_1301026_c1 3300050507 Bacteria 741
163 nmdc:mga06r32_1003356_c1 3300050510 Bacteria 787
164 nmdc:mga08y16_110894_c1 3300050511 Bacteria 2857
165 nmdc:mga0n895_226534_c1 3300050512 Bacteria 1897
166 nmdc:mga0n895_29938_c1 3300050512 Bacteria 5197
167 nmdc:mga0n895_89529_c1 3300050512 Bacteria 3078
168 nmdc:mga0rr50_197502_c1 3300050513 Unclassified 1652
169 nmdc:mga0rr50_586489_c1 3300050513 Bacteria 950
170 Ga0501084_0035262 3300054114 Bacteria 4182
171 Ga0501084_0073005 3300054114 Bacteria 2873
172 Ga0501084_0556070 3300054114 Bacteria 969
173 Ga0501082_0046015 3300060353 Bacteria 3762
174 Ga0501082_0119470 3300060353 Bacteria 2284
175 Ga0501082_0718542 3300060353 Bacteria 874
176 Ga0501082_0784750 3300060353 Bacteria 833
177 Ga0530510_0040241 3300061734 Bacteria 3373
178 Ga0530510_0309371 3300061734 Bacteria 1183
179 Ga0070687_100293337
180 Ga0068869_100364358
181 Ga0070687_100023002
182 Ga0070661_100680100
183 Ga0070669_100040467
184 Ga0070675_100408154
185 Ga0070705_100189704
186 Ga0070705_100243082
187 Ga0070708_100004742
188 Ga0070708_101118067
189 Ga0070662_100240220
190 Ga0070681_10030254
191 Ga0070681_10872378
192 Ga0070706_100000868
193 Ga0070706_100098855
194 Ga0070707_100036366
195 Ga0070707_100180091
196 Ga0070698_100110338
197 Ga0070698_100183572
198 Ga0070698_100186441
199 Ga0070698_100398549
200 Ga0070698_100545558
201 Ga0070699_100000071
202 Ga0070699_100029002
203 Ga0070699_100114656
204 Ga0070699_100203514
205 Ga0070684_100069178
206 Ga0070684_100075100
207 Ga0070686_100040380
208 Ga0070696_100006988
209 Ga0070693_100202826
210 Ga0070704_100102763
211 Ga0070664_100425566
212 Ga0068857_100187407
213 Ga0068854_100674431
214 Ga0070702_100226266
215 Ga0070702_100298073
216 Ga0068870_10221202
217 Ga0068863_100760324
218 Ga0068858_100686922
219 Ga0068862_100518151
220 Ga0081539_10049826
221 Ga0075433_10070657
222 Ga0075434_100045657
223 Ga0075434_100370934
224 Ga0075434_100598386
225 Ga0075435_100195887
226 Ga0099794_10003715
227 Ga0105245_10035959
228 Ga0105245_10039282
229 Ga0105245_10104465
230 Ga0114129_10023649
231 Ga0114129_10125446
232 Ga0114129_11460053
233 Ga0105242_10037230
234 Ga0105242_10619004
235 Ga0105246_10036223
236 Ga0105246_10260723
237 Ga0157378_10723891
238 Ga0157375_10272479
239 Ga0157375_10556949
240 Ga0163163_10276914
241 Ga0157380_10039516
242 Ga0182008_10269158
243 Ga0157377_10306681
244 Ga0157379_10228986
245 Ga0157376_10746132
246 Ga0207688_10038742
247 Ga0207643_10266548
248 Ga0207684_10000003
249 Ga0207684_10062770
250 Ga0207649_10586976
251 Ga0207646_10107195
252 Ga0207646_10274532
253 Ga0207687_10159165
254 Ga0207687_10227829
255 Ga0207687_10329189
256 Ga0207686_10500205
257 Ga0207679_10400924
258 Ga0207677_10218814
259 Ga0207641_10642492
260 Ga0207674_10266646
261 Ga0207674_10304486
262 Ga0209588_1003065
263 Ga0207428_10018020
264 Ga0307405_10337000
265 Ga0307416_100007918
266 Ga0307416_100316639
267 Ga0307415_100114184
268 Ga0307415_100163324
269 Ga0373940_0056078
270 Ga0450920_011997
271 Ga0495603_0095836
272 Ga0495644_0067981
273 Ga0495587_0065642
274 Ga0496102_0275523
275 Ga0496105_0012781
276 Ga0496108_0002585
277 Ga0496108_0007680
278 Ga0496109_0003307
279 Ga0496109_0007614
280 Ga0496109_0053375
281 Ga0496110_0001402
282 Ga0496112_0000005
283 Ga0496112_0291410
284 Ga0496112_0795637
285 Ga0496113_0006630
286 Ga0501031_0438855
287 Ga0501033_0162227
288 Ga0501036_0020612
289 Ga0501036_0156101
290 Ga0501036_0333944
291 Ga0501036_0553609
292 Ga0501037_0085069
293 Ga0501038_0016916
294 Ga0501038_0207150
295 Ga0501039_0009531
296 Ga0501039_0048197
297 Ga0501039_0096862
298 Ga0501040_0016481
299 Ga0501040_0025915
300 Ga0501040_0327519
301 Ga0501041_0013029
302 Ga0501042_0003349
303 Ga0501042_0050399
304 Ga0501042_0088934
305 Ga0501043_0070471
306 Ga0501048_0018342
307 Ga0501048_0056197
308 Ga0501048_0159606
309 Ga0501048_0288735
310 Ga0501067_0018273
311 Ga0501068_0003341
312 Ga0501068_0014683
313 Ga0501068_0339569
314 Ga0501068_0342140
315 Ga0501069_0029904
316 Ga0501069_0191024
317 Ga0501069_0308466
318 Ga0501070_0029940
319 Ga0501071_0094559
320 Ga0501071_0413857
321 Ga0501072_0040289
322 Ga0501072_0595399
323 Ga0501075_0035675
324 Ga0501075_0037116
325 Ga0501075_0096317
326 Ga0501075_0323409
327 Ga0501076_0012234
328 Ga0501076_0039936
329 Ga0501076_0084194
330 Ga0501079_0006605
331 Ga0501079_0307249
332 Ga0501080_0042785
333 Ga0501080_0114875
334 Ga0501081_0265222
335 Ga0501081_0662372
336 Ga0501083_0089214
337 Ga0501083_0161451
338 Ga0501035_0123760
339 Ga0501045_0216454
340 nmdc:mga05p37_1301026_c1
341 nmdc:mga06r32_1003356_c1
342 nmdc:mga08y16_110894_c1
343 nmdc:mga0n895_226534_c1
344 nmdc:mga0n895_29938_c1
345 nmdc:mga0n895_89529_c1
346 nmdc:mga0rr50_197502_c1
347 nmdc:mga0rr50_586489_c1
348 Ga0501084_0035262
349 Ga0501084_0073005
350 Ga0501084_0556070
351 Ga0501082_0046015
352 Ga0501082_0119470
353 Ga0501082_0718542
354 Ga0501082_0784750
355 Ga0530510_0040241
356 Ga0530510_0309371

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

14

193

0.9

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

11

187

0.89

PF13242

Hydrolase_like

HAD-hyrolase-like

148

222

0.86

PF12710

HAD

haloacid dehalogenase-like hydrolase

14

182

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s6j-assembly1.cif.gz_A the crystal structure of a hydrolase from pseudomonas syringae 0.8819 11 221
3s6j-assembly2.cif.gz_F the crystal structure of a hydrolase from pseudomonas syringae 0.8811 13 221
3s6j-assembly3.cif.gz_D the crystal structure of a hydrolase from pseudomonas syringae 0.8807 13 221
3s6j-assembly3.cif.gz_C the crystal structure of a hydrolase from pseudomonas syringae 0.8726 13 221
3s6j-assembly2.cif.gz_B the crystal structure of a hydrolase from pseudomonas syringae 0.8679 13 221
ID Description Score Start End Superfamily
3qucA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.918 27 93 1.10.150.240
3s6jB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8862 13 221 3.40.50.1000
4g9bA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.8822 24 90 1.10.150.240
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8756 98 194 3.40.50.1000
4ex7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8741 13 222 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A535VVP2-F1-model_v4 HAD family phosphatase 0.959 5 222 GO:0050308
AF-A0A536K994-F1-model_v4 HAD family phosphatase 0.9564 10 221 GO:0006281
GO:0008967
AF-A0A534MMM2-F1-model_v4 HAD family phosphatase 0.942 8 222 GO:0050308
AF-A0A535VVP2-F1-model_v4 HAD family phosphatase 0.934 5 222 GO:0050308
AF-A0A536BWD1-F1-model_v4 HAD family phosphatase 0.9292 5 219 GO:0006281
GO:0008967

Map