F271445

General Info

Members Datasets Scaffolds Average Seq Length
178 136 178 161

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100186843|Ga0070689_1001868432
Length 184
Sequence VKGGSGSRRHEQQGGSVEPHSLPSKRARQVAVIGSGGVEPGSELGLLAGEVGRLLAGARVTLVCGGLTGVMEAACRGASEAGGVAVGIVPGNSVEEANPHCTHVVATGIGHARNLAVVSSGDAVIAIGGEWGTLSEIGFARAIGRPVIALRSWTLSGRERMEDAPGVVPAESAREAVELALEVL

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
47 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
63 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
64 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
65 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
66 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
67 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
70 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
71 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
72 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
73 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
74 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
75 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
76 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
77 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
78 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
79 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
80 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
81 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
82 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
83 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
84 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
85 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
86 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
87 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
88 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
89 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
90 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
91 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
92 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
93 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
94 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
95 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
96 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
97 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
98 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
99 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
100 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
101 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
102 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
103 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
104 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
105 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
106 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
107 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
119 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
120 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
121 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
122 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
123 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
124 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
125 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
130 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
131 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
132 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
133 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
134 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.99
Nodule 0
Rhizoplane 9.55
Rhizosphere 81.46
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10024841 3300002459 Bacteria 1243
2 Ga0070690_100880724 3300005330 Bacteria 699
3 Ga0068869_101192211 3300005334 Unclassified 669
4 Ga0070682_100031900 3300005337 Bacteria 3191
5 Ga0070689_100186843 3300005340 Bacteria 1686
6 Ga0070689_100775263 3300005340 Bacteria 842
7 Ga0070671_100551991 3300005355 Bacteria 993
8 Ga0070674_100000016 3300005356 Bacteria 91058
9 Ga0070674_100000426 3300005356 Bacteria 21283
10 Ga0070674_100174400 3300005356 Bacteria 1642
11 Ga0070673_100365421 3300005364 Bacteria 1283
12 Ga0070688_100086421 3300005365 Bacteria 2040
13 Ga0070714_100082033 3300005435 Bacteria 2809
14 Ga0070710_10305232 3300005437 Bacteria 1040
15 Ga0070701_10468675 3300005438 Bacteria 812
16 Ga0070705_101016762 3300005440 Unclassified 674
17 Ga0070700_100222852 3300005441 Bacteria 1337
18 Ga0070678_100169289 3300005456 Bacteria 1778
19 Ga0070698_101105818 3300005471 Unclassified 741
20 Ga0070693_100000471 3300005547 Bacteria 18102
21 Ga0068866_10000006 3300005718 Bacteria 176129
22 Ga0068866_10000677 3300005718 Bacteria 15466
23 Ga0068858_100239372 3300005842 Bacteria 1722
24 Ga0068860_100049858 3300005843 Bacteria 3987
25 Ga0081455_10212092 3300005937 Bacteria 1442
26 Ga0075365_10000704 3300006038 Bacteria 13453
27 Ga0075365_10008613 3300006038 Bacteria 5808
28 Ga0075365_10038739 3300006038 Bacteria 3101
29 Ga0075365_10062730 3300006038 Bacteria 2486
30 Ga0075365_10356727 3300006038 Bacteria 1031
31 Ga0075363_100039768 3300006048 Bacteria 2476
32 Ga0075364_10340942 3300006051 Bacteria 1021
33 Ga0070716_100302269 3300006173 Bacteria 1114
34 Ga0070712_100056589 3300006175 Bacteria 2751
35 Ga0075428_100024719 3300006844 Bacteria 6647
36 Ga0075430_100008731 3300006846 Bacteria 8553
37 Ga0075430_100018776 3300006846 Bacteria 5883
38 Ga0075431_100004388 3300006847 Bacteria 13830
39 Ga0075431_100102488 3300006847 Bacteria 2954
40 Ga0075433_10502101 3300006852 Bacteria 1068
41 Ga0075434_100010367 3300006871 Bacteria 8735
42 Ga0075434_100066100 3300006871 Bacteria 3601
43 Ga0075429_100032479 3300006880 Bacteria 4537
44 Ga0075436_100162494 3300006914 Bacteria 1575
45 Ga0075436_100681498 3300006914 Bacteria 761
46 Ga0075435_100588925 3300007076 Bacteria 964
47 Ga0111539_10148377 3300009094 Unclassified 2745
48 Ga0111539_10511308 3300009094 Bacteria 1399
49 Ga0111539_11315936 3300009094 Unclassified 839
50 Ga0111539_11975076 3300009094 Bacteria 676
51 Ga0105245_10005090 3300009098 Bacteria 11563
52 Ga0114129_10021660 3300009147 Bacteria 9122
53 Ga0114129_10022399 3300009147 Bacteria 8971
54 Ga0114129_10839253 3300009147 Bacteria 1169
55 Ga0105243_10145918 3300009148 Bacteria 2024
56 Ga0105243_10256352 3300009148 Bacteria 1564
57 Ga0105241_10390272 3300009174 Bacteria 1219
58 Ga0105242_10105445 3300009176 Bacteria 2394
59 Ga0105242_10138069 3300009176 Bacteria 2112
60 Ga0105249_10809298 3300009553 Bacteria 1001
61 Ga0105239_10059412 3300010375 Bacteria 4196
62 Ga0105246_10234655 3300011119 Bacteria 1446
63 Ga0157380_10000249 3300014326 Bacteria 32409
64 Ga0163161_10000192 3300017792 Bacteria 56160
65 Ga0163161_10797913 3300017792 Unclassified 793
66 Ga0213873_10067720 3300021358 Bacteria 978
67 Ga0207642_10000001 3300025899 Bacteria 714030
68 Ga0207642_10000003 3300025899 Bacteria 650651
69 Ga0207642_10000004 3300025899 Bacteria 407822
70 Ga0207642_10000242 3300025899 Bacteria 16226
71 Ga0207688_10051202 3300025901 Bacteria 2313
72 Ga0207693_10016755 3300025915 Bacteria 5853
73 Ga0207663_10266533 3300025916 Bacteria 1267
74 Ga0207687_10818678 3300025927 Bacteria 795
75 Ga0207686_10128514 3300025934 Bacteria 1735
76 Ga0207686_10189461 3300025934 Bacteria 1465
77 Ga0207709_10085893 3300025935 Bacteria 2041
78 Ga0207709_11318656 3300025935 Unclassified 597
79 Ga0207670_10105313 3300025936 Bacteria 2022
80 Ga0207669_10000037 3300025937 Bacteria 77494
81 Ga0207669_10000070 3300025937 Bacteria 51898
82 Ga0207703_10253431 3300026035 Bacteria 1587
83 Ga0207708_10057536 3300026075 Bacteria 2966
84 Ga0207676_10000026 3300026095 Bacteria 248593
85 Ga0207683_10048196 3300026121 Bacteria 3731
86 Ga0207428_10060783 3300027907 Unclassified 2993
87 Ga0268264_10005165 3300028381 Bacteria 11064
88 Ga0307416_101700681 3300032002 Bacteria 736
89 Ga0373935_1341189 3300035692 Bacteria 534
90 Ga0373947_0835489 3300035725 Unclassified 629
91 Ga0395899_0083864 3300037312 Bacteria 2317
92 Ga0395900_0056491 3300037418 Bacteria 4040
93 Ga0395898_0007686 3300037466 Bacteria 11448
94 Ga0395898_0258392 3300037466 Bacteria 1661
95 Ga0395905_0006923 3300037471 Bacteria 11333
96 Ga0395901_0006693 3300038443 Bacteria 11645
97 Ga0395901_0070865 3300038443 Bacteria 3632
98 Ga0395901_0096196 3300038443 Bacteria 3104
99 Ga0436362_0133352 3300039453 Bacteria 1018
100 Ga0466963_0000002 3300044694 Bacteria 108477
101 Ga0466963_0180814 3300044694 Bacteria 1472
102 Ga0495592_0000497 3300046454 Bacteria 28666
103 Ga0495629_0174303 3300046459 Bacteria 1492
104 Ga0495641_0192650 3300046461 Bacteria 914
105 Ga0495653_0100705 3300046463 Bacteria 2094
106 Ga0495582_0103094 3300046473 Bacteria 1598
107 Ga0495639_0147164 3300046475 Bacteria 1135
108 Ga0495662_0000006 3300046476 Bacteria 79206
109 Ga0495608_0000227 3300046511 Bacteria 40662
110 Ga0495618_0000003 3300046514 Bacteria 256269
111 Ga0495628_0016504 3300046516 Bacteria 6159
112 Ga0495628_0314352 3300046516 Bacteria 1157
113 Ga0495630_0023846 3300046517 Bacteria 4522
114 Ga0495640_0014985 3300046533 Bacteria 5845
115 Ga0495586_0078541 3300046535 Bacteria 1811
116 Ga0495621_0163078 3300046539 Bacteria 882
117 Ga0495668_0296449 3300046616 Bacteria 886
118 Ga0495634_0000030 3300046642 Bacteria 110741
119 Ga0495634_0139104 3300046642 Bacteria 1543
120 Ga0495657_0040370 3300046675 Bacteria 3201
121 Ga0495647_0000780 3300046681 Bacteria 9472
122 Ga0495613_0000003 3300046689 Bacteria 248826
123 Ga0495670_0014440 3300046691 Bacteria 3883
124 Ga0495600_0003917 3300046809 Bacteria 8842
125 Ga0495581_0534022 3300047315 Bacteria 681
126 Ga0495604_0000056 3300047317 Bacteria 100110
127 Ga0495674_0746592 3300047319 Bacteria 765
128 Ga0495676_0024622 3300047321 Bacteria 5207
129 Ga0495680_0000272 3300047322 Bacteria 57553
130 Ga0495685_015540 3300047447 Bacteria 2597
131 Ga0495684_0392050 3300047471 Bacteria 977
132 Ga0496100_0176769 3300048903 Bacteria 1541
133 Ga0496101_0002233 3300048904 Bacteria 11839
134 Ga0496103_0033469 3300048906 Bacteria 3140
135 Ga0496104_0009573 3300048907 Bacteria 8625
136 Ga0496105_0016383 3300048908 Bacteria 5916
137 Ga0496106_0009169 3300048909 Bacteria 7307
138 Ga0496107_0010165 3300048910 Bacteria 6526
139 Ga0496108_0038213 3300048911 Bacteria 3999
140 Ga0496109_0568880 3300048912 Bacteria 1068
141 Ga0496110_0416622 3300048913 Bacteria 1224
142 Ga0496111_0736801 3300048914 Bacteria 715
143 Ga0496112_0000002 3300048915 Bacteria 782039
144 Ga0496112_0484188 3300048915 Bacteria 1173
145 Ga0496113_0060214 3300048916 Bacteria 2861
146 Ga0496113_0233668 3300048916 Bacteria 1466
147 Ga0496114_0006219 3300048917 Bacteria 9402
148 Ga0496115_0084400 3300048918 Bacteria 2589
149 Ga0501041_0936594 3300049577 Archaea 557
150 Ga0501042_0028787 3300049578 Bacteria 3918
151 Ga0501047_0487352 3300049581 Bacteria 1060
152 Ga0501075_0001174 3300049591 Bacteria 16946
153 Ga0501079_0316022 3300049741 Bacteria 1223
154 nmdc:mga03n38_79468_c1 3300050490 Bacteria 1538
155 nmdc:mga00v17_58622_c1 3300050491 Bacteria 2360
156 nmdc:mga00v17_60177_c1 3300050491 Bacteria 2332
157 nmdc:mga0yw44_11674_c1 3300050492 Bacteria 4548
158 nmdc:mga0yw44_17212_c1 3300050492 Bacteria 3928
159 nmdc:mga0yw44_215078_c1 3300050492 Bacteria 1272
160 nmdc:mga0yw44_2222_c1 3300050492 Bacteria 8180
161 nmdc:mga0yw44_4764_c1 3300050492 Bacteria 6286
162 nmdc:mga06z11_421072_c1 3300050494 Bacteria 805
163 nmdc:mga05p37_17990_c1 3300050507 Bacteria 8534
164 nmdc:mga0qj67_7459_c1 3300050509 Bacteria 8079
165 nmdc:mga06r32_29210_c1 3300050510 Bacteria 5166
166 nmdc:mga08y16_1422666_c1 3300050511 Bacteria 656
167 nmdc:mga08y16_316934_c1 3300050511 Bacteria 1606
168 nmdc:mga0n895_438920_c1 3300050512 Unclassified 1319
169 nmdc:mga0n895_9519_c1 3300050512 Bacteria 8506
170 nmdc:mga0rr50_255273_c1 3300050513 Bacteria 1457
171 nmdc:mga08x19_865974_c1 3300050514 Unclassified 642
172 nmdc:mga0a205_444406_c1 3300050515 Unclassified 1157
173 Ga0495601_0099855 3300053077 Bacteria 1874
174 Ga0495612_0000168 3300053078 Bacteria 27483
175 Ga0495595_0000084 3300053084 Bacteria 45392
176 Ga0495595_0305080 3300053084 Bacteria 801
177 Ga0501084_0430394 3300054114 Bacteria 1115
178 Ga0530510_0173382 3300061734 Bacteria 1598

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006038 Ga0075365_10008613 Ga0075365_100086133 124
2 3300035725 Ga0373947_0835489 Ga0373947_0835489_158_595 124
3 3300046459 Ga0495629_0174303 Ga0495629_0174303_457_948 125
4 3300049577 Ga0501041_0936594 Ga0501041_0936594_24_536 126
5 3300032002 Ga0307416_101700681 Ga0307416_1017006811 130
6 3300006847 Ga0075431_100004388 Ga0075431_10000438810 131
7 3300006852 Ga0075433_10502101 Ga0075433_105021012 131
8 3300006871 Ga0075434_100010367 Ga0075434_1000103679 131
9 3300007076 Ga0075435_100588925 Ga0075435_1005889251 131
10 3300009147 Ga0114129_10839253 Ga0114129_108392532 131
11 3300027907 Ga0207428_10060783 Ga0207428_100607833 131
12 3300046642 Ga0495634_0000030 Ga0495634_0000030_70194_70688 131
13 3300006844 Ga0075428_100024719 Ga0075428_1000247192 132
14 3300006846 Ga0075430_100018776 Ga0075430_1000187765 132
15 3300006847 Ga0075431_100102488 Ga0075431_1001024883 132
16 3300006880 Ga0075429_100032479 Ga0075429_1000324793 132
17 3300009094 Ga0111539_10511308 Ga0111539_105113082 132
18 3300009147 Ga0114129_10021660 Ga0114129_100216606 132
19 3300050492 nmdc:mga0yw44_4764_c1 nmdc:mga0yw44_4764_c1_616_1104 132
20 3300050507 nmdc:mga05p37_17990_c1 nmdc:mga05p37_17990_c1_5915_6379 132
21 3300050509 nmdc:mga0qj67_7459_c1 nmdc:mga0qj67_7459_c1_559_1023 132
22 3300005435 Ga0070714_100082033 Ga0070714_1000820333 133
23 3300021358 Ga0213873_10067720 Ga0213873_100677202 135
24 3300039453 Ga0436362_0133352 Ga0436362_0133352_288_755 135
25 3300047319 Ga0495674_0746592 Ga0495674_0746592_283_750 135
26 3300050512 nmdc:mga0n895_438920_c1 nmdc:mga0n895_438920_c1_22_501 135
27 3300050514 nmdc:mga08x19_865974_c1 nmdc:mga08x19_865974_c1_27_506 135
28 3300005471 Ga0070698_101105818 Ga0070698_1011058182 137
29 3300009094 Ga0111539_11975076 Ga0111539_119750761 137
30 3300037466 Ga0395898_0258392 Ga0395898_0258392_905_1390 137
31 3300038443 Ga0395901_0070865 Ga0395901_0070865_471_956 137
32 3300049581 Ga0501047_0487352 Ga0501047_0487352_274_747 137
33 3300050511 nmdc:mga08y16_1422666_c1 nmdc:mga08y16_1422666_c1_70_543 137
34 3300005356 Ga0070674_100000016 Ga0070674_10000001625 138
35 3300005718 Ga0068866_10000677 Ga0068866_1000067721 138
36 3300009148 Ga0105243_10145918 Ga0105243_101459183 138
37 3300009176 Ga0105242_10138069 Ga0105242_101380692 138
38 3300025899 Ga0207642_10000242 Ga0207642_1000024221 138
39 3300025934 Ga0207686_10128514 Ga0207686_101285143 138
40 3300025935 Ga0207709_10085893 Ga0207709_100858933 138
41 3300025937 Ga0207669_10000037 Ga0207669_1000003765 138
42 3300044694 Ga0466963_0000002 Ga0466963_0000002_2391_2867 138
43 3300005330 Ga0070690_100880724 Ga0070690_1008807241 139
44 3300005334 Ga0068869_101192211 Ga0068869_1011922111 139
45 3300005337 Ga0070682_100031900 Ga0070682_1000319002 139
46 3300005340 Ga0070689_100775263 Ga0070689_1007752631 139
47 3300005355 Ga0070671_100551991 Ga0070671_1005519912 139
48 3300005356 Ga0070674_100174400 Ga0070674_1001744002 139
49 3300005364 Ga0070673_100365421 Ga0070673_1003654211 139
50 3300005365 Ga0070688_100086421 Ga0070688_1000864211 139
51 3300005438 Ga0070701_10468675 Ga0070701_104686751 139
52 3300005440 Ga0070705_101016762 Ga0070705_1010167621 139
53 3300005456 Ga0070678_100169289 Ga0070678_1001692892 139
54 3300005842 Ga0068858_100239372 Ga0068858_1002393722 139
55 3300005937 Ga0081455_10212092 Ga0081455_102120922 139
56 3300006038 Ga0075365_10038739 Ga0075365_100387393 139
57 3300006038 Ga0075365_10062730 Ga0075365_100627304 139
58 3300006038 Ga0075365_10356727 Ga0075365_103567272 139
59 3300006048 Ga0075363_100039768 Ga0075363_1000397682 139
60 3300006051 Ga0075364_10340942 Ga0075364_103409422 139
61 3300006173 Ga0070716_100302269 Ga0070716_1003022692 139
62 3300006175 Ga0070712_100056589 Ga0070712_1000565892 139
63 3300006846 Ga0075430_100008731 Ga0075430_1000087316 139
64 3300006871 Ga0075434_100066100 Ga0075434_1000661004 139
65 3300006914 Ga0075436_100162494 Ga0075436_1001624942 139
66 3300006914 Ga0075436_100681498 Ga0075436_1006814982 139
67 3300009094 Ga0111539_10148377 Ga0111539_101483771 139
68 3300009094 Ga0111539_11315936 Ga0111539_113159362 139
69 3300009098 Ga0105245_10005090 Ga0105245_100050904 139
70 3300009147 Ga0114129_10022399 Ga0114129_100223996 139
71 3300009148 Ga0105243_10256352 Ga0105243_102563522 139
72 3300009174 Ga0105241_10390272 Ga0105241_103902722 139
73 3300009176 Ga0105242_10105445 Ga0105242_101054452 139
74 3300009553 Ga0105249_10809298 Ga0105249_108092982 139
75 3300010375 Ga0105239_10059412 Ga0105239_100594122 139
76 3300011119 Ga0105246_10234655 Ga0105246_102346552 139
77 3300017792 Ga0163161_10797913 Ga0163161_107979132 139
78 3300025901 Ga0207688_10051202 Ga0207688_100512022 139
79 3300025915 Ga0207693_10016755 Ga0207693_100167552 139
80 3300025916 Ga0207663_10266533 Ga0207663_102665332 139
81 3300025927 Ga0207687_10818678 Ga0207687_108186782 139
82 3300025934 Ga0207686_10189461 Ga0207686_101894612 139
83 3300025935 Ga0207709_11318656 Ga0207709_113186562 139
84 3300026035 Ga0207703_10253431 Ga0207703_102534312 139
85 3300026121 Ga0207683_10048196 Ga0207683_100481964 139
86 3300037312 Ga0395899_0083864 Ga0395899_0083864_1122_1613 139
87 3300037418 Ga0395900_0056491 Ga0395900_0056491_773_1264 139
88 3300037466 Ga0395898_0007686 Ga0395898_0007686_10203_10694 139
89 3300037471 Ga0395905_0006923 Ga0395905_0006923_10140_10631 139
90 3300038443 Ga0395901_0006693 Ga0395901_0006693_806_1297 139
91 3300038443 Ga0395901_0096196 Ga0395901_0096196_636_1127 139
92 3300046473 Ga0495582_0103094 Ga0495582_0103094_944_1435 139
93 3300046475 Ga0495639_0147164 Ga0495639_0147164_618_1109 139
94 3300047315 Ga0495581_0534022 Ga0495581_0534022_66_557 139
95 3300047321 Ga0495676_0024622 Ga0495676_0024622_965_1456 139
96 3300048903 Ga0496100_0176769 Ga0496100_0176769_663_1154 139
97 3300048904 Ga0496101_0002233 Ga0496101_0002233_7944_8435 139
98 3300048906 Ga0496103_0033469 Ga0496103_0033469_2385_2876 139
99 3300048907 Ga0496104_0009573 Ga0496104_0009573_6613_7104 139
100 3300048908 Ga0496105_0016383 Ga0496105_0016383_147_638 139
101 3300048909 Ga0496106_0009169 Ga0496106_0009169_4889_5380 139
102 3300048910 Ga0496107_0010165 Ga0496107_0010165_219_710 139
103 3300048911 Ga0496108_0038213 Ga0496108_0038213_3429_3920 139
104 3300048912 Ga0496109_0568880 Ga0496109_0568880_386_877 139
105 3300048913 Ga0496110_0416622 Ga0496110_0416622_591_1082 139
106 3300048914 Ga0496111_0736801 Ga0496111_0736801_194_685 139
107 3300048915 Ga0496112_0484188 Ga0496112_0484188_308_799 139
108 3300048916 Ga0496113_0060214 Ga0496113_0060214_2359_2850 139
109 3300048917 Ga0496114_0006219 Ga0496114_0006219_8645_9136 139
110 3300048918 Ga0496115_0084400 Ga0496115_0084400_1498_1989 139
111 3300049741 Ga0501079_0316022 Ga0501079_0316022_722_1210 139
112 3300050490 nmdc:mga03n38_79468_c1 nmdc:mga03n38_79468_c1_643_1137 139
113 3300050491 nmdc:mga00v17_58622_c1 nmdc:mga00v17_58622_c1_790_1296 139
114 3300050491 nmdc:mga00v17_60177_c1 nmdc:mga00v17_60177_c1_775_1269 139
115 3300050492 nmdc:mga0yw44_17212_c1 nmdc:mga0yw44_17212_c1_2194_2700 139
116 3300050492 nmdc:mga0yw44_215078_c1 nmdc:mga0yw44_215078_c1_420_914 139
117 3300050492 nmdc:mga0yw44_2222_c1 nmdc:mga0yw44_2222_c1_1440_1931 139
118 3300050494 nmdc:mga06z11_421072_c1 nmdc:mga06z11_421072_c1_182_676 139
119 3300050510 nmdc:mga06r32_29210_c1 nmdc:mga06r32_29210_c1_4363_4854 139
120 3300050511 nmdc:mga08y16_316934_c1 nmdc:mga08y16_316934_c1_95_586 139
121 3300050512 nmdc:mga0n895_9519_c1 nmdc:mga0n895_9519_c1_352_843 139
122 3300050513 nmdc:mga0rr50_255273_c1 nmdc:mga0rr50_255273_c1_202_693 139
123 3300050515 nmdc:mga0a205_444406_c1 nmdc:mga0a205_444406_c1_272_763 139
124 3300054114 Ga0501084_0430394 Ga0501084_0430394_595_1083 139
125 3300061734 Ga0530510_0173382 Ga0530510_0173382_769_1257 139
126 3300046511 Ga0495608_0000227 Ga0495608_0000227_36925_37407 140
127 3300046516 Ga0495628_0016504 Ga0495628_0016504_1667_2149 140
128 3300017792 Ga0163161_10000192 Ga0163161_1000019216 141
129 3300035692 Ga0373935_1341189 Ga0373935_1341189_36_521 141
130 3300046454 Ga0495592_0000497 Ga0495592_0000497_7411_7896 141
131 3300046461 Ga0495641_0192650 Ga0495641_0192650_216_701 141
132 3300046463 Ga0495653_0100705 Ga0495653_0100705_925_1410 141
133 3300046514 Ga0495618_0000003 Ga0495618_0000003_151382_151867 141
134 3300046517 Ga0495630_0023846 Ga0495630_0023846_1865_2350 141
135 3300046533 Ga0495640_0014985 Ga0495640_0014985_3454_3939 141
136 3300046535 Ga0495586_0078541 Ga0495586_0078541_713_1198 141
137 3300046539 Ga0495621_0163078 Ga0495621_0163078_280_765 141
138 3300046616 Ga0495668_0296449 Ga0495668_0296449_247_732 141
139 3300046642 Ga0495634_0139104 Ga0495634_0139104_140_625 141
140 3300046675 Ga0495657_0040370 Ga0495657_0040370_85_570 141
141 3300046681 Ga0495647_0000780 Ga0495647_0000780_24_509 141
142 3300046689 Ga0495613_0000003 Ga0495613_0000003_147419_147904 141
143 3300046691 Ga0495670_0014440 Ga0495670_0014440_2334_2819 141
144 3300046809 Ga0495600_0003917 Ga0495600_0003917_431_916 141
145 3300047317 Ga0495604_0000056 Ga0495604_0000056_35731_36216 141
146 3300047447 Ga0495685_015540 Ga0495685_015540_260_745 141
147 3300047471 Ga0495684_0392050 Ga0495684_0392050_358_843 141
148 3300048916 Ga0496113_0233668 Ga0496113_0233668_538_1023 141
149 3300049591 Ga0501075_0001174 Ga0501075_0001174_13881_14366 141
150 3300053084 Ga0495595_0000084 Ga0495595_0000084_3258_3743 141
151 3300014326 Ga0157380_10000249 Ga0157380_100002495 142
152 3300044694 Ga0466963_0180814 Ga0466963_0180814_811_1320 142
153 3300046476 Ga0495662_0000006 Ga0495662_0000006_18329_18817 142
154 3300047322 Ga0495680_0000272 Ga0495680_0000272_20393_20881 142
155 3300048915 Ga0496112_0000002 Ga0496112_0000002_443235_443732 142
156 3300049578 Ga0501042_0028787 Ga0501042_0028787_880_1374 142
157 3300046516 Ga0495628_0314352 Ga0495628_0314352_504_995 143
158 3300053077 Ga0495601_0099855 Ga0495601_0099855_327_818 143
159 3300053078 Ga0495612_0000168 Ga0495612_0000168_7138_7629 143
160 3300053084 Ga0495595_0305080 Ga0495595_0305080_245_736 143
161 3300006038 Ga0075365_10000704 Ga0075365_100007045 144
162 3300050492 nmdc:mga0yw44_11674_c1 nmdc:mga0yw44_11674_c1_2203_2709 144
163 3300005441 Ga0070700_100222852 Ga0070700_1002228522 149
164 3300026075 Ga0207708_10057536 Ga0207708_100575362 149
165 3300005356 Ga0070674_100000426 Ga0070674_10000042610 153
166 3300005718 Ga0068866_10000006 Ga0068866_100000062 153
167 3300005843 Ga0068860_100049858 Ga0068860_1000498582 153
168 3300025899 Ga0207642_10000001 Ga0207642_10000001199 153
169 3300025899 Ga0207642_10000003 Ga0207642_10000003199 153
170 3300025899 Ga0207642_10000004 Ga0207642_10000004199 153
171 3300025937 Ga0207669_10000070 Ga0207669_100000707 153
172 3300026095 Ga0207676_10000026 Ga0207676_1000002695 153
173 3300028381 Ga0268264_10005165 Ga0268264_100051656 153
174 3300002459 JGI24751J29686_10024841 JGI24751J29686_100248412 164
175 3300005340 Ga0070689_100186843 Ga0070689_1001868432 164
176 3300005437 Ga0070710_10305232 Ga0070710_103052322 164
177 3300005547 Ga0070693_100000471 Ga0070693_10000047114 164
178 3300025936 Ga0207670_10105313 Ga0207670_101053132 164

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03641

Lysine_decarbox

Possible lysine decarboxylase

71

140

0.94

PF18306

LDcluster4

SLOG cluster4 family

27

177

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ax6-assembly2.cif.gz_C crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermotoga maritima 0.7899 28 106
3ax6-assembly1.cif.gz_B crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermotoga maritima 0.7882 28 127
3orq-assembly1.cif.gz_B crystal structure of n5-carboxyaminoimidazole synthetase from staphylococcus aureus complexed with adp 0.7735 28 106
3orr-assembly1.cif.gz_B crystal structure of n5-carboxyaminoimidazole synthetase from staphylococcus aureus 0.7572 28 106
3ax6-assembly2.cif.gz_D crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermotoga maritima 0.7421 28 127
ID Description Score Start End Superfamily
af_Q54QE4_620_731_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7962 27 106 3.40.50.20
3v4sB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7325 28 106 3.40.50.20
4bjyA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.6976 28 73 3.50.50.60
3ax6D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.6901 28 127 3.40.50.20
af_Q9VDU2_19_435_3.40.50.12780 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.6831 28 158 3.40.50.12780
ID Description Score Start End GO Terms
AF-A0A0F8ZLV8-F1-model_v4 TIGR00725 family protein 0.773 66 164
AF-A0A534JZG4-F1-model_v4 Glycosyltransferase family 4 protein 0.7711 27 130 GO:0016757
GO:0045226
AF-A0A537A1T5-F1-model_v4 Uncharacterized protein 0.7548 72 163
AF-A0A810N730-F1-model_v4 Epimerase 0.7533 28 129 GO:0009055
GO:0016620
GO:0020037
GO:0046872
GO:0051287
AF-A0A7C8ACK1-F1-model_v4 TIGR00725 family protein 0.7499 68 162

Feature Viewer

pLDDT pTM Quality
75.21 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map