F271092

General Info

Members Datasets Scaffolds Average Seq Length
177 110 354 421

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2818991318|2819425775
Length 483
Sequence RGRRVTKRKIGVTPAWQGLKNPRVIVAALRRHVRPPSPLAGRLSAQSLLFALGEGTFMTGSAVFFTQIVGLSAAQVGLGLTIAGVAAFLAALPMGKLVDRFGPRRMWALSAAGQAAMFSVWPFITGFDGYVAMAVGMEVIGALGGAAYGAYTIDVLPAGERVKSRAYMYSALNVGFTLGSMLGGIALAFHSNDVLHALPWFTALMFLVNAVAIGRLPKAAHDERTPEERKVKVPGPGPLRNPGWLLTSFFIGVFWTNQVLLNVVIPLWLVEKTDAPRVLLAFLFGTNTVMCIFLPMVTSRGVRNVPTALRAVRISSVFFVVSCIITLATHDTVGWVTIALVWLGHVTVTGAELYMSAASWSFEAELMDPRQRGAYQGAAELSATLGKVWAPAVYTFLAMNWGAGGWLVIAAIIVVATVGIHPATRRAKEFLTLHVPADVLADARASAPEPEEGLAVGSPGAPGVVDVVGAGDPTREGAADPMR

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
9 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
10 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
12 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
13 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
14 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
15 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
16 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
17 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
18 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
19 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
20 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
21 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
22 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
23 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
31 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
32 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
33 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
34 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
35 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
36 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
37 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
38 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
39 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
40 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
41 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
42 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
43 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
44 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
45 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
46 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
47 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
48 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
49 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
50 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
51 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
52 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
53 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
54 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
55 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
56 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
57 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
58 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
59 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
60 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
61 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
62 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
69 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
77 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
78 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
79 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
80 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
81 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
82 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
83 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
84 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
85 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
86 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
87 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
88 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
89 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
90 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
91 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
92 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
93 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
94 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
95 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
96 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
97 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
98 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
99 2643221561 Nocardioides sp. Root151 Isolate Unclassified
100 2643221615 Nocardioides sp. Root224 Isolate Unclassified
101 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
102 2643221679 Angustibacter sp. Root456 Isolate Unclassified
103 2643221696 Nocardioides sp. Root140 Isolate Unclassified
104 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
105 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
106 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
107 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
108 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
109 2902582711 Micromonospora sp. AP08 Isolate Unclassified
110 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.66
Metatranscriptomes 0
Isolates 7.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.69
Nodule 0
Rhizoplane 7.34
Rhizosphere 70.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10015039 3300001979 Bacteria 2836
2 Ga0070658_10121025 3300005327 Bacteria 2175
3 Ga0070660_100005631 3300005339 Bacteria 8681
4 Ga0070660_100029050 3300005339 Bacteria 4141
5 Ga0070659_100115567 3300005366 Bacteria 2169
6 Ga0070667_100005273 3300005367 Bacteria 10813
7 Ga0070700_100076161 3300005441 Bacteria 2154
8 Ga0070663_100004853 3300005455 Bacteria 7933
9 Ga0070696_100013983 3300005546 Bacteria 5390
10 Ga0070664_100024537 3300005564 Bacteria 4988
11 Ga0081539_10020215 3300005985 Bacteria 4514
12 Ga0075365_10023949 3300006038 Bacteria 3845
13 Ga0075365_10032348 3300006038 Bacteria 3361
14 Ga0075365_10081304 3300006038 Bacteria 2195
15 Ga0075365_10081657 3300006038 Bacteria 2190
16 Ga0075368_10002907 3300006042 Bacteria 5658
17 Ga0075363_100000053 3300006048 Bacteria 22667
18 Ga0075363_100004756 3300006048 Bacteria 5983
19 Ga0075363_100040891 3300006048 Bacteria 2444
20 Ga0075363_100066223 3300006048 Bacteria 1955
21 Ga0075364_10006644 3300006051 Bacteria 6815
22 Ga0075364_10026061 3300006051 Bacteria 3727
23 Ga0075364_10027277 3300006051 Bacteria 3647
24 Ga0075364_10034014 3300006051 Bacteria 3285
25 Ga0075367_10034506 3300006178 Bacteria 2923
26 Ga0075370_10003692 3300006353 Bacteria 7330
27 Ga0075370_10141730 3300006353 Bacteria 1405
28 Ga0075434_100241109 3300006871 Bacteria 1828
29 Ga0105239_10032293 3300010375 Bacteria 5754
30 Ga0157372_10188127 3300013307 Bacteria 2391
31 Ga0157375_10156336 3300013308 Bacteria 2419
32 Ga0163163_10086581 3300014325 Bacteria 3142
33 Ga0157380_10056565 3300014326 Bacteria 3120
34 Ga0207647_10028681 3300025904 Bacteria 3612
35 Ga0207647_10046773 3300025904 Bacteria 2695
36 Ga0207657_10007877 3300025919 Bacteria 10871
37 Ga0207652_10014967 3300025921 Bacteria 6292
38 Ga0207690_10026904 3300025932 Bacteria 3629
39 Ga0207679_10016023 3300025945 Bacteria 4968
40 Ga0207708_10058695 3300026075 Bacteria 2936
41 Ga0268264_10000264 3300028381 Bacteria 93499
42 Ga0307508_10015007 3300031616 Bacteria 7062
43 Ga0307508_10099422 3300031616 Bacteria 2503
44 Ga0307516_10050423 3300031730 Bacteria 4084
45 Ga0307405_10019471 3300031731 Bacteria 3771
46 Ga0307406_10116042 3300031901 Bacteria 1852
47 Ga0307409_100265885 3300031995 Bacteria 1577
48 Ga0307416_100013208 3300032002 Bacteria 5605
49 Ga0307415_100000246 3300032126 Bacteria 23474
50 Ga0307415_100001828 3300032126 Bacteria 10427
51 Ga0395900_0055592 3300037418 Bacteria 4076
52 Ga0395900_0063824 3300037418 Bacteria 3786
53 Ga0395900_0224188 3300037418 Bacteria 1893
54 Ga0395900_0232556 3300037418 Bacteria 1853
55 Ga0395898_0194862 3300037466 Bacteria 1936
56 Ga0451843_1272910 3300041509 Bacteria 1621
57 Ga0439464_0016654 3300042439 Bacteria 1989
58 Ga0466969_0079008 3300044656 Bacteria 1573
59 Ga0466972_0054009 3300044658 Bacteria 1934
60 Ga0466965_0026111 3300044683 Bacteria 2831
61 Ga0466965_0027705 3300044683 Bacteria 2751
62 Ga0466966_0036240 3300044684 Bacteria 3186
63 Ga0466966_0057131 3300044684 Bacteria 2467
64 Ga0466961_0017438 3300044693 Bacteria 4613
65 Ga0466961_0105228 3300044693 Bacteria 1777
66 Ga0466963_0033546 3300044694 Bacteria 3334
67 Ga0466964_0024597 3300044706 Bacteria 2347
68 Ga0466964_0071380 3300044706 Bacteria 1469
69 Ga0466971_0025075 3300044719 Bacteria 2663
70 Ga0466971_0066945 3300044719 Bacteria 1628
71 Ga0466968_0008105 3300044735 Bacteria 4018
72 Ga0466970_0014612 3300044765 Bacteria 4032
73 Ga0466970_0015976 3300044765 Bacteria 3865
74 Ga0466970_0017902 3300044765 Bacteria 3664
75 Ga0466970_0036170 3300044765 Bacteria 2615
76 Ga0466970_0073968 3300044765 Bacteria 1834
77 Ga0466970_0077287 3300044765 Bacteria 1794
78 Ga0466960_0022427 3300044901 Bacteria 2823
79 Ga0466960_0025936 3300044901 Bacteria 2657
80 Ga0466960_0037304 3300044901 Bacteria 2279
81 Ga0466960_0041709 3300044901 Bacteria 2175
82 Ga0466960_0043172 3300044901 Bacteria 2143
83 Ga0466958_0081131 3300045836 Bacteria 1996
84 Ga0466967_0054338 3300045976 Bacteria 3524
85 Ga0466967_0116074 3300045976 Bacteria 2466
86 Ga0466967_0175313 3300045976 Bacteria 2020
87 Ga0466967_0223312 3300045976 Bacteria 1791
88 Ga0496100_0095088 3300048903 Bacteria 2042
89 Ga0496102_0055080 3300048905 Bacteria 3627
90 Ga0496102_0073803 3300048905 Bacteria 3135
91 Ga0496106_0099169 3300048909 Bacteria 2258
92 Ga0496108_0000128 3300048911 Bacteria 74691
93 Ga0496109_0223378 3300048912 Bacteria 1771
94 Ga0496110_0138531 3300048913 Bacteria 2200
95 Ga0496110_0142149 3300048913 Bacteria 2169
96 Ga0496111_0061552 3300048914 Bacteria 2721
97 Ga0496111_0095953 3300048914 Bacteria 2176
98 Ga0496114_0015527 3300048917 Bacteria 6123
99 Ga0496114_0021812 3300048917 Bacteria 5212
100 Ga0496114_0228876 3300048917 Bacteria 1633
101 Ga0501031_0020600 3300049568 Bacteria 4300
102 Ga0501032_0002611 3300049569 Bacteria 14086
103 Ga0501032_0135218 3300049569 Bacteria 1625
104 Ga0501033_0002329 3300049570 Bacteria 16184
105 Ga0501034_0011184 3300049571 Bacteria 9315
106 Ga0501034_0137950 3300049571 Bacteria 2419
107 Ga0501036_0009941 3300049572 Bacteria 7834
108 Ga0501036_0060069 3300049572 Bacteria 3220
109 Ga0501037_0011319 3300049573 Bacteria 6566
110 Ga0501038_0003607 3300049574 Bacteria 14414
111 Ga0501039_0051492 3300049575 Bacteria 3186
112 Ga0501040_0085625 3300049576 Bacteria 2187
113 Ga0501041_0017068 3300049577 Bacteria 4319
114 Ga0501043_0014550 3300049579 Bacteria 6160
115 Ga0501046_0000707 3300049580 Bacteria 32240
116 Ga0501046_0003461 3300049580 Bacteria 14486
117 Ga0501046_0033228 3300049580 Bacteria 4170
118 Ga0501046_0052418 3300049580 Bacteria 3215
119 Ga0501047_0020396 3300049581 Bacteria 6365
120 Ga0501048_0009446 3300049582 Bacteria 7321
121 Ga0501048_0101626 3300049582 Bacteria 2028
122 Ga0501048_0189901 3300049582 Bacteria 1456
123 Ga0501067_0003252 3300049583 Bacteria 8946
124 Ga0501067_0011544 3300049583 Bacteria 4895
125 Ga0501067_0044210 3300049583 Bacteria 2475
126 Ga0501070_0043833 3300049586 Bacteria 3722
127 Ga0501070_0048288 3300049586 Bacteria 3536
128 Ga0501070_0076926 3300049586 Bacteria 2762
129 Ga0501070_0184288 3300049586 Bacteria 1717
130 Ga0501071_0005192 3300049587 Bacteria 8340
131 Ga0501071_0050090 3300049587 Bacteria 3008
132 Ga0501072_0164943 3300049588 Bacteria 1767
133 Ga0501073_0016799 3300049589 Bacteria 5302
134 Ga0501073_0020412 3300049589 Bacteria 4778
135 Ga0501073_0094787 3300049589 Bacteria 2073
136 Ga0501074_0006075 3300049590 Bacteria 8720
137 Ga0501074_0072424 3300049590 Bacteria 2475
138 Ga0501075_0145903 3300049591 Bacteria 1803
139 Ga0501076_0037992 3300049592 Bacteria 3778
140 Ga0501076_0154094 3300049592 Bacteria 1870
141 Ga0501077_0023537 3300049593 Bacteria 3906
142 Ga0501079_0033978 3300049741 Bacteria 3923
143 Ga0501079_0103713 3300049741 Bacteria 2206
144 Ga0501080_0009817 3300049742 Bacteria 8747
145 Ga0501080_0146948 3300049742 Bacteria 2179
146 Ga0501083_0060062 3300049744 Bacteria 2541
147 Ga0501035_0017466 3300049822 Bacteria 6617
148 Ga0501035_0037653 3300049822 Bacteria 4379
149 nmdc:mga03n38_38916_c1 3300050490 Bacteria 2060
150 nmdc:mga00v17_18296_c1 3300050491 Bacteria 3977
151 nmdc:mga00v17_56173_c1 3300050491 Bacteria 2406
152 nmdc:mga00v17_66723_c1 3300050491 Bacteria 2222
153 nmdc:mga0yw44_120471_c1 3300050492 Bacteria 1690
154 nmdc:mga0yw44_18614_c1 3300050492 Bacteria 3809
155 nmdc:mga0yw44_22637_c1 3300050492 Bacteria 3526
156 nmdc:mga0yw44_79121_c1 3300050492 Bacteria 2057
157 Ga0500644_0000063 3300053088 Bacteria 62716
158 Ga0500554_026811 3300053102 Bacteria 1660
159 Ga0501084_0038788 3300054114 Bacteria 3983
160 Ga0501084_0040573 3300054114 Bacteria 3894
161 Ga0501082_0013716 3300060353 Bacteria 6965
162 Ga0501082_0235199 3300060353 Bacteria 1594
163 Ga0466962_0043536 3300061719 Bacteria 2148
164 Ga0530510_0035616 3300061734 Bacteria 3587
165 2819425775 2818991318 Bacteria 5266538
166 2643824698 2643221561 Bacteria 4984412
167 2644090288 2643221615 Bacteria 5487866
168 2644320133 2643221657 Bacteria 5490246
169 2644447520 2643221679 Bacteria 3839507
170 2644535950 2643221696 Bacteria 5431823
171 2808873049 2808606365 Bacteria 4301966
172 2812334857 2811994874 Bacteria 5367947
173 2819667824 2818991458 Bacteria 4794049
174 2855388720 2855386786 Bacteria 4752232
175 2887482318 2887478801 Bacteria 8972725
176 2902582791 2902582711 Bacteria 6187705
177 8057572881 8057568493 Bacteria 7221719
178 JGI24740J21852_10015039
179 Ga0070658_10121025
180 Ga0070660_100005631
181 Ga0070660_100029050
182 Ga0070659_100115567
183 Ga0070667_100005273
184 Ga0070700_100076161
185 Ga0070663_100004853
186 Ga0070696_100013983
187 Ga0070664_100024537
188 Ga0081539_10020215
189 Ga0075365_10023949
190 Ga0075365_10032348
191 Ga0075365_10081304
192 Ga0075365_10081657
193 Ga0075368_10002907
194 Ga0075363_100000053
195 Ga0075363_100004756
196 Ga0075363_100040891
197 Ga0075363_100066223
198 Ga0075364_10006644
199 Ga0075364_10026061
200 Ga0075364_10027277
201 Ga0075364_10034014
202 Ga0075367_10034506
203 Ga0075370_10003692
204 Ga0075370_10141730
205 Ga0075434_100241109
206 Ga0105239_10032293
207 Ga0157372_10188127
208 Ga0157375_10156336
209 Ga0163163_10086581
210 Ga0157380_10056565
211 Ga0207647_10028681
212 Ga0207647_10046773
213 Ga0207657_10007877
214 Ga0207652_10014967
215 Ga0207690_10026904
216 Ga0207679_10016023
217 Ga0207708_10058695
218 Ga0268264_10000264
219 Ga0307508_10015007
220 Ga0307508_10099422
221 Ga0307516_10050423
222 Ga0307405_10019471
223 Ga0307406_10116042
224 Ga0307409_100265885
225 Ga0307416_100013208
226 Ga0307415_100000246
227 Ga0307415_100001828
228 Ga0395900_0055592
229 Ga0395900_0063824
230 Ga0395900_0224188
231 Ga0395900_0232556
232 Ga0395898_0194862
233 Ga0451843_1272910
234 Ga0439464_0016654
235 Ga0466969_0079008
236 Ga0466972_0054009
237 Ga0466965_0026111
238 Ga0466965_0027705
239 Ga0466966_0036240
240 Ga0466966_0057131
241 Ga0466961_0017438
242 Ga0466961_0105228
243 Ga0466963_0033546
244 Ga0466964_0024597
245 Ga0466964_0071380
246 Ga0466971_0025075
247 Ga0466971_0066945
248 Ga0466968_0008105
249 Ga0466970_0014612
250 Ga0466970_0015976
251 Ga0466970_0017902
252 Ga0466970_0036170
253 Ga0466970_0073968
254 Ga0466970_0077287
255 Ga0466960_0022427
256 Ga0466960_0025936
257 Ga0466960_0037304
258 Ga0466960_0041709
259 Ga0466960_0043172
260 Ga0466958_0081131
261 Ga0466967_0054338
262 Ga0466967_0116074
263 Ga0466967_0175313
264 Ga0466967_0223312
265 Ga0496100_0095088
266 Ga0496102_0055080
267 Ga0496102_0073803
268 Ga0496106_0099169
269 Ga0496108_0000128
270 Ga0496109_0223378
271 Ga0496110_0138531
272 Ga0496110_0142149
273 Ga0496111_0061552
274 Ga0496111_0095953
275 Ga0496114_0015527
276 Ga0496114_0021812
277 Ga0496114_0228876
278 Ga0501031_0020600
279 Ga0501032_0002611
280 Ga0501032_0135218
281 Ga0501033_0002329
282 Ga0501034_0011184
283 Ga0501034_0137950
284 Ga0501036_0009941
285 Ga0501036_0060069
286 Ga0501037_0011319
287 Ga0501038_0003607
288 Ga0501039_0051492
289 Ga0501040_0085625
290 Ga0501041_0017068
291 Ga0501043_0014550
292 Ga0501046_0000707
293 Ga0501046_0003461
294 Ga0501046_0033228
295 Ga0501046_0052418
296 Ga0501047_0020396
297 Ga0501048_0009446
298 Ga0501048_0101626
299 Ga0501048_0189901
300 Ga0501067_0003252
301 Ga0501067_0011544
302 Ga0501067_0044210
303 Ga0501070_0043833
304 Ga0501070_0048288
305 Ga0501070_0076926
306 Ga0501070_0184288
307 Ga0501071_0005192
308 Ga0501071_0050090
309 Ga0501072_0164943
310 Ga0501073_0016799
311 Ga0501073_0020412
312 Ga0501073_0094787
313 Ga0501074_0006075
314 Ga0501074_0072424
315 Ga0501075_0145903
316 Ga0501076_0037992
317 Ga0501076_0154094
318 Ga0501077_0023537
319 Ga0501079_0033978
320 Ga0501079_0103713
321 Ga0501080_0009817
322 Ga0501080_0146948
323 Ga0501083_0060062
324 Ga0501035_0017466
325 Ga0501035_0037653
326 nmdc:mga03n38_38916_c1
327 nmdc:mga00v17_18296_c1
328 nmdc:mga00v17_56173_c1
329 nmdc:mga00v17_66723_c1
330 nmdc:mga0yw44_120471_c1
331 nmdc:mga0yw44_18614_c1
332 nmdc:mga0yw44_22637_c1
333 nmdc:mga0yw44_79121_c1
334 Ga0500644_0000063
335 Ga0500554_026811
336 Ga0501084_0038788
337 Ga0501084_0040573
338 Ga0501082_0013716
339 Ga0501082_0235199
340 Ga0466962_0043536
341 Ga0530510_0035616
342 2819425775
343 2643824698
344 2644090288
345 2644320133
346 2644447520
347 2644535950
348 2808873049
349 2812334857
350 2819667824
351 2855388720
352 2887482318
353 2902582791
354 8057572881

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

43

391

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6t1z-assembly1.cif.gz_A lmrp from l. lactis, in an outward-open conformation, bound to hoechst 33342 0.7789 18 400
8wx4-assembly1.cif.gz_A cryo-em structure of human slc15a4 in complex with lys-leu (outward-facing open) 0.7578 18 401
6t1z-assembly1.cif.gz_A lmrp from l. lactis, in an outward-open conformation, bound to hoechst 33342 0.7555 18 400
8ex5-assembly1.cif.gz_A human s1p transporter spns2 in an outward-facing open conformation (state 4) 0.7547 18 404
7lo8-assembly1.cif.gz_Z nora in complex with fab36 0.749 18 400
ID Description Score Start End Superfamily
af_E7FB53_277_463_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8776 18 176 1.20.1250.20
af_Q4D047_16_187_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.869 24 179 1.20.1250.20
af_A0A1D8PTY2_330_568_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8584 15 180 1.20.1250.20
af_Q54XU7_308_497_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8569 18 179 1.20.1250.20
af_X1WCQ3_534_686_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8521 43 182 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7W5FAQ4-F1-model_v4 MFS family permease 0.9701 1 404 GO:0016020
GO:0022857
AF-A0A7Y9S356-F1-model_v4 MFS family permease 0.9411 6 404 GO:0016020
GO:0022857
AF-A0A1C4YCY2-F1-model_v4 Major Facilitator Superfamily protein 0.925 87 400 GO:0005886
GO:0022857
AF-A0A0Q8UND0-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9243 4 404 GO:0016020
GO:0022857
AF-A0A1J5Q8D1-F1-model_v4 Major facilitator superfamily protein 0.9197 54 396 GO:0005886
GO:0022857

Map