F270464

General Info

Members Datasets Scaffolds Average Seq Length
177 125 354 398

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10001127|Ga0307516_100011275
Length 450
Sequence MSKSTTTLLVAGRARGPPSMPRPMAAMGRLHRSKTIYKEFMMGISNSGFTETGLRRLRDVLAGHVESKRIPGLVALVSRGGQTHVEAVGTLRHDGGAPMRRDTIFRMASTSKPVAMAAAMVLLDECRLRLDDTVEQWLPELAGRRVLTRIDAPLDDTVPARRPITVRDLLTSTFGLGMDMTALGTPIIGALFEQAIYPQSMTDYPEPDEWMRRLGELPLMYQPGERWQYHISHDVLGVLVARVTGQSFEAFLRERILDPLGMNDTGFHVPADKIDRLPVSYAPDPQTGEFIVWDEAEGGQYSQPLAFQSGGSGLVSTVDDYNTYLRMLLNGGSHNGERVLSRPAVRLMTTNRLTPEQQAARDTMARDLVHLSHGQGQHGGWGFGMAVRTYRGDYAPIGQFGWDGGTGTSAYADPDNQLTGVLLTQVAMSVPDSAQAIHDFWTTTYQAIDD

Samples

Sample ID Description Type Environment
1 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
10 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
11 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
12 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
16 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
17 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
18 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
19 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
20 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
21 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
22 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
23 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
24 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
36 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
37 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
38 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
39 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
40 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
41 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
42 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
43 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
44 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
45 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
46 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
47 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
48 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
49 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
50 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
51 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
52 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
53 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
54 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
55 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
56 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
57 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
58 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
59 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
60 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
61 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
62 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
63 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
64 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
65 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
66 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
67 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
68 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
69 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
70 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
71 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
72 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
73 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
74 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
75 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
76 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
77 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
78 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
79 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
80 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
81 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
82 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
83 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
84 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
85 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
86 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
88 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
89 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
90 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
91 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
92 2643221613 Oerskovia sp. Root22 Isolate Unclassified
93 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
94 2643221721 Oerskovia sp. Root918 Isolate Unclassified
95 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
96 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
97 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
98 2738541358 Bacillus sp. OV752 Isolate Unclassified
99 2738543006 Bacillus sp. OK077 Isolate Unclassified
100 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
101 2818991459 Paenibacillus sp. 597 Isolate Unclassified
102 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
103 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
104 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
105 2862574272 Streptomyces sp. AcE210 Isolate Nodule
106 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
107 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
108 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
109 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
110 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
111 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
112 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
113 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
114 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
115 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
116 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
117 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
118 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
119 2965761152 Bacillus sp. COPE52 Isolate Unclassified
120 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
121 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
122 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
123 8022792930 Bacillus sp. Xin Isolate Rhizosphere
124 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
125 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.58
Metatranscriptomes 0.56
Isolates 24.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.95
Nodule 0.56
Rhizoplane 1.69
Rhizosphere 70.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307516_10001127 3300031730 Bacteria 37233
2 JGI25151J46595_10033976 3300003187 Bacteria 1956
3 Ga0070683_100151285 3300005329 Bacteria 2201
4 Ga0070670_100173040 3300005331 Bacteria 1873
5 Ga0070668_100000687 3300005347 Bacteria 23027
6 Ga0070671_100140703 3300005355 Bacteria 2036
7 Ga0070667_100031404 3300005367 Bacteria 4430
8 Ga0070667_100096711 3300005367 Bacteria 2547
9 Ga0070665_100081045 3300005548 Bacteria 3251
10 Ga0068856_100114665 3300005614 Bacteria 2694
11 Ga0068864_100032387 3300005618 Bacteria 4442
12 Ga0068863_100036653 3300005841 Bacteria 4671
13 Ga0068860_100116534 3300005843 Bacteria 2556
14 Ga0081455_10028925 3300005937 Bacteria 5058
15 Ga0081539_10000135 3300005985 Bacteria 172789
16 Ga0105244_10055547 3300009036 Bacteria 2006
17 Ga0105244_10080027 3300009036 Bacteria 1619
18 Ga0105250_10004282 3300009092 Bacteria 6591
19 Ga0105245_10081121 3300009098 Bacteria 2965
20 Ga0157372_10188676 3300013307 Bacteria 2387
21 Ga0157372_10237372 3300013307 Bacteria 2115
22 Ga0157379_10032564 3300014968 Bacteria 4647
23 Ga0224712_10045374 3300022467 Bacteria 1681
24 Ga0209130_1000882 3300025284 Bacteria 24475
25 Ga0209025_1000806 3300025294 Bacteria 50533
26 Ga0209025_1012871 3300025294 Bacteria 5316
27 Ga0209025_1044735 3300025294 Bacteria 1845
28 Ga0207426_1021996 3300025302 Bacteria 2195
29 Ga0207696_1006383 3300025711 Bacteria 4759
30 Ga0207655_1011849 3300025728 Bacteria 5150
31 Ga0207713_1010607 3300025735 Bacteria 5085
32 Ga0207687_10101797 3300025927 Bacteria 2115
33 Ga0207644_10082991 3300025931 Bacteria 2372
34 Ga0207661_10109179 3300025944 Bacteria 2337
35 Ga0207668_10001826 3300025972 Bacteria 12428
36 Ga0207702_10078586 3300026078 Bacteria 2857
37 Ga0207641_10044676 3300026088 Bacteria 3726
38 Ga0207641_10150464 3300026088 Bacteria 2108
39 Ga0207676_10075105 3300026095 Bacteria 2725
40 Ga0268266_10045548 3300028379 Bacteria 3752
41 Ga0307515_10033452 3300028794 Bacteria 8463
42 Ga0307515_10097243 3300028794 Bacteria 3600
43 Ga0307512_10036451 3300030522 Bacteria 4170
44 Ga0307513_10034326 3300031456 Bacteria 5694
45 Ga0307513_10133553 3300031456 Bacteria 2422
46 Ga0307509_10007667 3300031507 Bacteria 14026
47 Ga0307509_10048829 3300031507 Bacteria 4542
48 Ga0307509_10109864 3300031507 Bacteria 2765
49 Ga0307509_10145677 3300031507 Bacteria 2295
50 Ga0307508_10000738 3300031616 Bacteria 38723
51 Ga0307508_10036441 3300031616 Bacteria 4428
52 Ga0307508_10089467 3300031616 Bacteria 2663
53 Ga0307508_10218247 3300031616 Bacteria 1507
54 Ga0307516_10000360 3300031730 Bacteria 59179
55 Ga0307516_10174279 3300031730 Bacteria 1889
56 Ga0373940_0001523 3300035088 Bacteria 4225
57 Ga0373943_0139194 3300035170 Bacteria 1306
58 Ga0373942_0000136 3300035207 Bacteria 17474
59 Ga0373962_0005777 3300035242 Bacteria 2986
60 Ga0466970_0008480 3300044765 Bacteria 5174
61 Ga0495603_0000193 3300046455 Bacteria 31870
62 Ga0495603_0038387 3300046455 Bacteria 2872
63 Ga0495629_0004919 3300046459 Bacteria 10030
64 Ga0495629_0005270 3300046459 Bacteria 9665
65 Ga0495629_0010026 3300046459 Bacteria 6914
66 Ga0495638_0147029 3300046460 Bacteria 1370
67 Ga0495582_0047922 3300046473 Bacteria 2353
68 Ga0495605_0070360 3300046474 Bacteria 1655
69 Ga0495605_0077543 3300046474 Bacteria 1558
70 Ga0495639_0002140 3300046475 Bacteria 8712
71 Ga0495662_0034801 3300046476 Bacteria 2431
72 Ga0495585_0006807 3300046492 Bacteria 7054
73 Ga0495585_0093572 3300046492 Bacteria 1616
74 Ga0495594_0023141 3300046499 Bacteria 3326
75 Ga0495596_0024955 3300046500 Bacteria 2418
76 Ga0495607_0005822 3300046501 Bacteria 8766
77 Ga0495607_0015995 3300046501 Bacteria 4849
78 Ga0495583_0043238 3300046506 Bacteria 2098
79 Ga0495606_0051720 3300046507 Bacteria 2677
80 Ga0495616_0016170 3300046513 Bacteria 4134
81 Ga0495620_0004351 3300046515 Bacteria 8002
82 Ga0495620_0009479 3300046515 Bacteria 5175
83 Ga0495631_0032349 3300046518 Bacteria 2360
84 Ga0495631_0074582 3300046518 Bacteria 1464
85 Ga0495648_0028440 3300046524 Bacteria 3723
86 Ga0495648_0068426 3300046524 Bacteria 2071
87 Ga0495666_0008279 3300046526 Bacteria 5211
88 Ga0495666_0080753 3300046526 Bacteria 1538
89 Ga0495597_0024746 3300046542 Bacteria 2769
90 Ga0495633_0013489 3300046558 Bacteria 4305
91 Ga0495633_0085871 3300046558 Bacteria 1463
92 Ga0495668_0000296 3300046616 Bacteria 68521
93 Ga0495668_0016758 3300046616 Bacteria 4258
94 Ga0495668_0060596 3300046616 Bacteria 2087
95 Ga0495634_0149595 3300046642 Bacteria 1477
96 Ga0495625_0003461 3300046660 Bacteria 15719
97 Ga0495625_0007222 3300046660 Bacteria 9723
98 Ga0495625_0152517 3300046660 Bacteria 1552
99 Ga0495661_0054832 3300046665 Bacteria 2392
100 Ga0495613_0111264 3300046689 Bacteria 1973
101 Ga0495624_0037848 3300046690 Bacteria 3102
102 Ga0495624_0167602 3300046690 Bacteria 1340
103 Ga0495671_0129405 3300046692 Bacteria 1231
104 Ga0495649_0012729 3300046694 Bacteria 4880
105 Ga0495589_0002097 3300046794 Bacteria 11261
106 Ga0495589_0018710 3300046794 Bacteria 3551
107 Ga0495589_0051405 3300046794 Bacteria 2037
108 Ga0495660_0046440 3300046810 Bacteria 2381
109 Ga0495636_0061526 3300047318 Bacteria 1588
110 Ga0495636_0069695 3300047318 Bacteria 1499
111 Ga0495676_0001969 3300047321 Bacteria 18048
112 Ga0495676_0008024 3300047321 Bacteria 9678
113 Ga0495676_0016640 3300047321 Bacteria 6516
114 Ga0495683_0006419 3300047323 Bacteria 6428
115 Ga0495687_010885 3300047443 Bacteria 4941
116 Ga0495687_017782 3300047443 Bacteria 3531
117 Ga0495687_053077 3300047443 Bacteria 1709
118 Ga0495685_034886 3300047447 Bacteria 1728
119 Ga0495685_037221 3300047447 Bacteria 1669
120 Ga0495686_0086968 3300047472 Bacteria 1902
121 Ga0495686_0129600 3300047472 Bacteria 1496
122 Ga0495614_0005703 3300048089 Bacteria 5612
123 Ga0495614_0010527 3300048089 Bacteria 4078
124 Ga0495626_0001925 3300048091 Bacteria 15433
125 Ga0496102_0228597 3300048905 Bacteria 1754
126 Ga0496110_0005599 3300048913 Bacteria 9860
127 Ga0496111_0138952 3300048914 Bacteria 1800
128 Ga0501047_0055850 3300049581 Bacteria 3818
129 Ga0501044_0067094 3300049823 Bacteria 3656
130 Ga0501044_0076523 3300049823 Bacteria 3396
131 Ga0501044_0098837 3300049823 Bacteria 2938
132 Ga0501044_0123052 3300049823 Bacteria 2593
133 Ga0500600_0038792 3300053149 Bacteria 2756
134 2512731768 2512564039 Bacteria 8739048
135 2512733253 2512564039 Bacteria 8739048
136 2515856767 2515154155 Bacteria 7985436
137 2644018157 2643221601 Bacteria 7493239
138 2644083395 2643221613 Bacteria 4622396
139 2644177317 2643221631 Bacteria 8168043
140 2644666320 2643221721 Bacteria 4486924
141 2672333272 2671180330 Bacteria 5521719
142 2672335853 2671180330 Bacteria 5521719
143 2676487467 2675903059 Bacteria 8644972
144 2676493623 2675903060 Bacteria 10051191
145 2739155376 2738541358 Bacteria 5932299
146 2739208155 2738543006 Bacteria 5904091
147 2753264963 2751185782 Bacteria 11227053
148 2819674409 2818991459 Bacteria 8736032
149 2857470770 2857465823 Bacteria 6772595
150 2857596974 2857591370 Bacteria 6569758
151 2861524946 2861520306 Bacteria 8348283
152 2861526140 2861520306 Bacteria 8348283
153 2862581760 2862574272 Bacteria 10567477
154 2865007764 2865002811 Bacteria 6333767
155 2867314725 2867312974 Bacteria 7058875
156 2867322263 2867319477 Bacteria 7069771
157 2873316878 2873314349 Bacteria 8512634
158 2884698843 2884693830 Bacteria 11273186
159 2884701046 2884693830 Bacteria 11273186
160 2889049640 2889049205 Bacteria 7524325
161 2889054468 2889049205 Bacteria 7524325
162 2891399978 2891395885 Bacteria 9251614
163 2895430112 2895427314 Bacteria 13147766
164 2904758319 2904755435 Bacteria 7986759
165 2918501154 2918501144 Bacteria 8668083
166 2918508941 2918501144 Bacteria 8668083
167 2919427961 2919425241 Bacteria 8055701
168 2929208253 2929206907 Bacteria 5918291
169 2935393798 2935390628 Bacteria 7043367
170 2965764528 2965761152 Bacteria 5806513
171 2979086878 2979083700 Bacteria 5894929
172 2997455684 2997451912 Bacteria 8492419
173 3003004247 3002998708 Bacteria 11715108
174 8022794173 8022792930 Bacteria 5693794
175 8055070961 8055066027 Bacteria 9479577
176 8057571783 8057568493 Bacteria 7221719
177 8057572108 8057568493 Bacteria 7221719
178 Ga0307516_10001127
179 JGI25151J46595_10033976
180 Ga0070683_100151285
181 Ga0070670_100173040
182 Ga0070668_100000687
183 Ga0070671_100140703
184 Ga0070667_100031404
185 Ga0070667_100096711
186 Ga0070665_100081045
187 Ga0068856_100114665
188 Ga0068864_100032387
189 Ga0068863_100036653
190 Ga0068860_100116534
191 Ga0081455_10028925
192 Ga0081539_10000135
193 Ga0105244_10055547
194 Ga0105244_10080027
195 Ga0105250_10004282
196 Ga0105245_10081121
197 Ga0157372_10188676
198 Ga0157372_10237372
199 Ga0157379_10032564
200 Ga0224712_10045374
201 Ga0209130_1000882
202 Ga0209025_1000806
203 Ga0209025_1012871
204 Ga0209025_1044735
205 Ga0207426_1021996
206 Ga0207696_1006383
207 Ga0207655_1011849
208 Ga0207713_1010607
209 Ga0207687_10101797
210 Ga0207644_10082991
211 Ga0207661_10109179
212 Ga0207668_10001826
213 Ga0207702_10078586
214 Ga0207641_10044676
215 Ga0207641_10150464
216 Ga0207676_10075105
217 Ga0268266_10045548
218 Ga0307515_10033452
219 Ga0307515_10097243
220 Ga0307512_10036451
221 Ga0307513_10034326
222 Ga0307513_10133553
223 Ga0307509_10007667
224 Ga0307509_10048829
225 Ga0307509_10109864
226 Ga0307509_10145677
227 Ga0307508_10000738
228 Ga0307508_10036441
229 Ga0307508_10089467
230 Ga0307508_10218247
231 Ga0307516_10000360
232 Ga0307516_10174279
233 Ga0373940_0001523
234 Ga0373943_0139194
235 Ga0373942_0000136
236 Ga0373962_0005777
237 Ga0466970_0008480
238 Ga0495603_0000193
239 Ga0495603_0038387
240 Ga0495629_0004919
241 Ga0495629_0005270
242 Ga0495629_0010026
243 Ga0495638_0147029
244 Ga0495582_0047922
245 Ga0495605_0070360
246 Ga0495605_0077543
247 Ga0495639_0002140
248 Ga0495662_0034801
249 Ga0495585_0006807
250 Ga0495585_0093572
251 Ga0495594_0023141
252 Ga0495596_0024955
253 Ga0495607_0005822
254 Ga0495607_0015995
255 Ga0495583_0043238
256 Ga0495606_0051720
257 Ga0495616_0016170
258 Ga0495620_0004351
259 Ga0495620_0009479
260 Ga0495631_0032349
261 Ga0495631_0074582
262 Ga0495648_0028440
263 Ga0495648_0068426
264 Ga0495666_0008279
265 Ga0495666_0080753
266 Ga0495597_0024746
267 Ga0495633_0013489
268 Ga0495633_0085871
269 Ga0495668_0000296
270 Ga0495668_0016758
271 Ga0495668_0060596
272 Ga0495634_0149595
273 Ga0495625_0003461
274 Ga0495625_0007222
275 Ga0495625_0152517
276 Ga0495661_0054832
277 Ga0495613_0111264
278 Ga0495624_0037848
279 Ga0495624_0167602
280 Ga0495671_0129405
281 Ga0495649_0012729
282 Ga0495589_0002097
283 Ga0495589_0018710
284 Ga0495589_0051405
285 Ga0495660_0046440
286 Ga0495636_0061526
287 Ga0495636_0069695
288 Ga0495676_0001969
289 Ga0495676_0008024
290 Ga0495676_0016640
291 Ga0495683_0006419
292 Ga0495687_010885
293 Ga0495687_017782
294 Ga0495687_053077
295 Ga0495685_034886
296 Ga0495685_037221
297 Ga0495686_0086968
298 Ga0495686_0129600
299 Ga0495614_0005703
300 Ga0495614_0010527
301 Ga0495626_0001925
302 Ga0496102_0228597
303 Ga0496110_0005599
304 Ga0496111_0138952
305 Ga0501047_0055850
306 Ga0501044_0067094
307 Ga0501044_0076523
308 Ga0501044_0098837
309 Ga0501044_0123052
310 Ga0500600_0038792
311 2512731768
312 2512733253
313 2515856767
314 2644018157
315 2644083395
316 2644177317
317 2644666320
318 2672333272
319 2672335853
320 2676487467
321 2676493623
322 2739155376
323 2739208155
324 2753264963
325 2819674409
326 2857470770
327 2857596974
328 2861524946
329 2861526140
330 2862581760
331 2865007764
332 2867314725
333 2867322263
334 2873316878
335 2884698843
336 2884701046
337 2889049640
338 2889054468
339 2891399978
340 2895430112
341 2904758319
342 2918501154
343 2918508941
344 2919427961
345 2929208253
346 2935393798
347 2965764528
348 2979086878
349 2997455684
350 3003004247
351 8022794173
352 8055070961
353 8057571783
354 8057572108

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00144

Beta-lactamase

Beta-lactamase

57

439

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7uda-assembly1.cif.gz_A structure of the estg 0.9049 8 407
7u1b-assembly1.cif.gz_A crystal structure of estg in complex with tantalum cluster 0.8767 8 410
7u1c-assembly1.cif.gz_A structure of estg crystalized with so4 and tris 0.8706 8 410
7pp8-assembly1.cif.gz_A structure of ester-hydrolase eh7 from metagenome of marine sediments at milazzo harbor (sicily, italy) complexed with a derivative of methyl 4-nitrophenyl hexylphosphonate 0.8703 16 410
7uda-assembly1.cif.gz_A structure of the estg 0.8636 8 407
ID Description Score Start End Superfamily
af_P9WLZ3_5_376_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8737 18 397 3.40.710.10
af_P9WLZ3_5_376_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8647 18 397 3.40.710.10
4ivkA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8471 8 407 3.40.710.10
af_A0A1D8PKX8_25_403_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.836 30 400 3.40.710.10
4m40A02 Alpha Beta;Alpha-Beta Complex;Hemagglutinin (Ha1 Chain); Chain: A; domain 1;Haemagglutinin, alpha/beta domain, HA1 chain 0.8275 32 48 3.90.209.20
ID Description Score Start End GO Terms
AF-A0A1C4Y9M2-F1-model_v4 Beta-lactamase 0.9563 1 301
AF-A0A656TJX4-F1-model_v4 deleted 0.9454 18 239
AF-A0A1G9JGJ5-F1-model_v4 CubicO group peptidase, beta-lactamase class C family 0.9412 17 406
AF-A0A0G2ZQB1-F1-model_v4 deleted 0.9394 8 407
AF-A0A1C4Y9M2-F1-model_v4 Beta-lactamase 0.9379 1 301

Map