F270303

General Info

Members Datasets Scaffolds Average Seq Length
177 124 354 249

Family's Representative Sequence

Representative Sequence 3300025893|Ga0207682_10075297|Ga0207682_100752972
Length 271
Sequence MTAGETRTAIRVGGDTGYDVVVGRGVVAELGDALGPNVRKVLVVLDLKRIGYEIDPIVPFMGDDRFSALSPLRRIPVLIDDRVTLTDSSVICQYLEDRWPEPALYPRDVADRAWARWLEEFADTRMGDVFIWRLFNQLVIRPFVWGEPTDDAVVQKTLAEDVPAVLDYLEGQAPADGFFFGALSIADVAVAVFFRNAGWARFKIDAARWPRIAGLVDRTLRSDGFQAVRPFEDTSMRMPPTEQRAALLALGAPLMQESYGTTTPRRGVMSV

Samples

Sample ID Description Type Environment
1 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
68 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
69 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
70 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
71 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
72 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
73 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
74 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
75 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
78 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
79 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
80 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
81 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
82 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
83 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
84 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
85 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
86 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
87 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
88 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
89 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
90 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
91 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
92 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
93 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
94 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
102 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
105 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
106 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
107 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
118 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
119 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
120 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
121 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
122 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
123 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
124 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.21
Rhizosphere 93.79
Stem 0
Stem Tuber 0
Unclassified 20.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207682_10075297 3300025893 Bacteria 1437
2 JGI25405J52794_10038778 3300003911 Unclassified 1004
3 Ga0070676_10082625 3300005328 Bacteria 1952
4 Ga0070670_100059169 3300005331 Bacteria 3289
5 Ga0070660_100111443 3300005339 Bacteria 2177
6 Ga0070689_100267964 3300005340 Bacteria 1413
7 Ga0070675_100221952 3300005354 Bacteria 1646
8 Ga0070675_100396316 3300005354 Bacteria 1231
9 Ga0070675_100450501 3300005354 Bacteria 1154
10 Ga0070659_100105165 3300005366 Bacteria 2274
11 Ga0070667_100217084 3300005367 Bacteria 1701
12 Ga0070705_100221025 3300005440 Unclassified 1312
13 Ga0070708_100066423 3300005445 Bacteria 3238
14 Ga0070708_100093017 3300005445 Bacteria 2748
15 Ga0068867_100184048 3300005459 Bacteria 1663
16 Ga0068867_100267066 3300005459 Unclassified 1397
17 Ga0070698_100019122 3300005471 Bacteria 7201
18 Ga0070699_100007396 3300005518 Bacteria 9562
19 Ga0070697_100553520 3300005536 Unclassified 1009
20 Ga0070672_100180118 3300005543 Bacteria 1761
21 Ga0070695_100002211 3300005545 Bacteria 11155
22 Ga0070704_100313650 3300005549 Bacteria 1311
23 Ga0070704_100418494 3300005549 Bacteria 1147
24 Ga0068856_100187375 3300005614 Bacteria 2083
25 Ga0068859_100233067 3300005617 Unclassified 1929
26 Ga0068864_100117403 3300005618 Bacteria 2375
27 Ga0068861_100116615 3300005719 Bacteria 2147
28 Ga0068863_100089233 3300005841 Unclassified 2923
29 Ga0068863_100292509 3300005841 Bacteria 1579
30 Ga0068860_100119877 3300005843 Unclassified 2519
31 Ga0081455_10000341 3300005937 Bacteria 61041
32 Ga0081540_1000493 3300005983 Bacteria 38816
33 Ga0081539_10090146 3300005985 Bacteria 1586
34 Ga0070715_10018273 3300006163 Bacteria 2669
35 Ga0070715_10069774 3300006163 Bacteria 1567
36 Ga0075428_100009530 3300006844 Bacteria 10783
37 Ga0075428_100039961 3300006844 Bacteria 5163
38 Ga0075431_100005361 3300006847 Bacteria 12657
39 Ga0075431_100183707 3300006847 Bacteria 2145
40 Ga0075431_100253616 3300006847 Bacteria 1787
41 Ga0075431_100926649 3300006847 Unclassified 840
42 Ga0075433_10001122 3300006852 Bacteria 19376
43 Ga0075433_10479671 3300006852 Bacteria 1096
44 Ga0075434_100001564 3300006871 Bacteria 19411
45 Ga0075434_100046069 3300006871 Bacteria 4327
46 Ga0075434_100075620 3300006871 Bacteria 3362
47 Ga0075429_100699171 3300006880 Bacteria 888
48 Ga0075436_100051416 3300006914 Bacteria 2844
49 Ga0075436_100091502 3300006914 Bacteria 2115
50 Ga0097620_100233070 3300006931 Unclassified 1929
51 Ga0075435_100263167 3300007076 Unclassified 1470
52 Ga0111539_10009295 3300009094 Bacteria 12413
53 Ga0111539_10079576 3300009094 Bacteria 3855
54 Ga0111539_10112658 3300009094 Bacteria 3191
55 Ga0111539_10174088 3300009094 Bacteria 2514
56 Ga0111539_10299783 3300009094 Bacteria 1871
57 Ga0111539_10509623 3300009094 Bacteria 1401
58 Ga0114129_10320960 3300009147 Unclassified 2059
59 Ga0105243_10557567 3300009148 Bacteria 1096
60 Ga0105248_10217692 3300009177 Unclassified 2151
61 Ga0105248_10232935 3300009177 Unclassified 2073
62 Ga0163162_10219880 3300013306 Bacteria 2029
63 Ga0157375_10179925 3300013308 Bacteria 2266
64 Ga0157375_10671242 3300013308 Bacteria 1191
65 Ga0163163_10851982 3300014325 Bacteria 975
66 Ga0163161_10074487 3300017792 Bacteria 2489
67 Ga0207685_10056210 3300025905 Bacteria 1539
68 Ga0207645_10096989 3300025907 Bacteria 1900
69 Ga0207646_10361526 3300025922 Unclassified 1311
70 Ga0207650_10490255 3300025925 Unclassified 1026
71 Ga0207659_10049414 3300025926 Bacteria 2984
72 Ga0207659_10299224 3300025926 Bacteria 1321
73 Ga0207687_10238320 3300025927 Bacteria 1440
74 Ga0207644_10513225 3300025931 Bacteria 990
75 Ga0207690_10173269 3300025932 Bacteria 1618
76 Ga0207670_10469906 3300025936 Unclassified 1017
77 Ga0207691_10190642 3300025940 Bacteria 1788
78 Ga0207711_10557198 3300025941 Unclassified 1069
79 Ga0207651_10247369 3300025960 Bacteria 1457
80 Ga0207658_10142098 3300025986 Bacteria 1944
81 Ga0207658_10187229 3300025986 Unclassified 1718
82 Ga0207658_10632192 3300025986 Bacteria 964
83 Ga0207678_10088951 3300026067 Bacteria 2640
84 Ga0207708_10026698 3300026075 Unclassified 4372
85 Ga0207708_10049403 3300026075 Bacteria 3202
86 Ga0207702_10239925 3300026078 Bacteria 1698
87 Ga0207641_10175354 3300026088 Unclassified 1960
88 Ga0207641_10345606 3300026088 Bacteria 1417
89 Ga0207648_10452393 3300026089 Unclassified 1169
90 Ga0207676_10111603 3300026095 Bacteria 2289
91 Ga0207675_100139957 3300026118 Bacteria 2298
92 Ga0207428_10005810 3300027907 Bacteria 11441
93 Ga0207428_10269843 3300027907 Bacteria 1265
94 Ga0268265_10071223 3300028380 Bacteria 2707
95 Ga0268265_10319370 3300028380 Bacteria 1406
96 Ga0268265_10532464 3300028380 Unclassified 1112
97 Ga0265338_10043444 3300028800 Bacteria 4168
98 Ga0265330_10024033 3300031235 Bacteria 2764
99 Ga0265330_10071234 3300031235 Bacteria 1504
100 Ga0265332_10000053 3300031238 Bacteria 108878
101 Ga0265332_10031626 3300031238 Bacteria 2307
102 Ga0265328_10004403 3300031239 Bacteria 6119
103 Ga0265320_10004760 3300031240 Bacteria 8833
104 Ga0265320_10024298 3300031240 Bacteria 3208
105 Ga0265325_10010705 3300031241 Bacteria 5296
106 Ga0265329_10035600 3300031242 Bacteria 1606
107 Ga0265339_10002655 3300031249 Bacteria 12744
108 Ga0265331_10000130 3300031250 Bacteria 99140
109 Ga0265331_10017344 3300031250 Bacteria 3758
110 Ga0265331_10067479 3300031250 Bacteria 1678
111 Ga0265316_10000085 3300031344 Bacteria 99136
112 Ga0265313_10078979 3300031595 Bacteria 1499
113 Ga0265314_10000254 3300031711 Bacteria 79030
114 Ga0265314_10000540 3300031711 Bacteria 48694
115 Ga0265342_10074947 3300031712 Bacteria 1965
116 Ga0316576_10121222 3300031727 Unclassified 1963
117 Ga0316578_10297743 3300031728 Bacteria 965
118 Ga0373948_0009268 3300034817 Unclassified 1695
119 Ga0373950_0009332 3300034818 Bacteria 1564
120 Ga0373958_0006953 3300034819 Unclassified 1785
121 Ga0373959_0015262 3300034820 Bacteria 1409
122 Ga0373940_0004191 3300035088 Bacteria 3028
123 Ga0373949_0044430 3300035090 Unclassified 1102
124 Ga0373951_0014785 3300035091 Bacteria 1756
125 Ga0373939_0004653 3300035114 Bacteria 3252
126 Ga0373941_0035454 3300035115 Unclassified 1511
127 Ga0373961_0018860 3300035241 Bacteria 1806
128 Ga0373962_0009755 3300035242 Bacteria 2384
129 Ga0373962_0026599 3300035242 Bacteria 1561
130 Ga0316574_0029201 3300035398 Unclassified 3330
131 Ga0373931_0000330 3300035691 Bacteria 19735
132 Ga0373931_0013359 3300035691 Bacteria 3997
133 Ga0373935_0029665 3300035692 Bacteria 3385
134 Ga0373927_0070956 3300035695 Bacteria 2254
135 Ga0373947_0003907 3300035725 Bacteria 8765
136 Ga0373937_0310103 3300036401 Bacteria 1492
137 Ga0316584_0145460 3300036712 Unclassified 1766
138 Ga0373925_0019593 3300037068 Bacteria 4923
139 Ga0436361_1067640 3300039447 Bacteria 1460
140 Ga0439449_0130807 3300042007 Bacteria 933
141 Ga0495629_0279766 3300046459 Bacteria 1145
142 Ga0495584_0054835 3300046491 Bacteria 2006
143 Ga0495640_0336020 3300046533 Bacteria 934
144 Ga0495680_0149616 3300047322 Bacteria 1703
145 Ga0496102_0035634 3300048905 Bacteria 4480
146 Ga0496104_0628495 3300048907 Unclassified 983
147 Ga0496105_0154432 3300048908 Unclassified 1885
148 Ga0496106_0148457 3300048909 Unclassified 1848
149 Ga0496109_0127354 3300048912 Unclassified 2374
150 Ga0496109_0455668 3300048912 Bacteria 1208
151 Ga0496110_0394213 3300048913 Unclassified 1262
152 Ga0496110_0541288 3300048913 Bacteria 1058
153 Ga0496112_0204985 3300048915 Bacteria 1930
154 Ga0496113_0148532 3300048916 Unclassified 1848
155 Ga0496115_0022670 3300048918 Bacteria 4868
156 Ga0501034_0277724 3300049571 Bacteria 1615
157 Ga0501073_0071646 3300049589 Bacteria 2414
158 nmdc:mga05p37_185076_c1 3300050507 Bacteria 2532
159 nmdc:mga05p37_318004_c1 3300050507 Bacteria 1843
160 nmdc:mga05p37_71730_c1 3300050507 Bacteria 4261
161 nmdc:mga06r32_12856_c1 3300050510 Bacteria 7567
162 nmdc:mga06r32_528199_c1 3300050510 Bacteria 1155
163 nmdc:mga06r32_94269_c1 3300050510 Bacteria 2929
164 nmdc:mga08y16_159063_c1 3300050511 Bacteria 2347
165 nmdc:mga08y16_473212_c1 3300050511 Bacteria 1275
166 nmdc:mga08y16_54709_c1 3300050511 Bacteria 4170
167 nmdc:mga08y16_638916_c1 3300050511 Unclassified 1070
168 nmdc:mga0n895_41606_c1 3300050512 Bacteria 4468
169 nmdc:mga0n895_453514_c1 3300050512 Bacteria 1294
170 nmdc:mga0n895_63858_c1 3300050512 Bacteria 3641
171 nmdc:mga0n895_7653_c1 3300050512 Bacteria 9289
172 nmdc:mga0rr50_321124_c1 3300050513 Unclassified 1298
173 nmdc:mga0rr50_431557_c1 3300050513 Bacteria 1115
174 nmdc:mga0rr50_449108_c1 3300050513 Bacteria 1093
175 nmdc:mga08x19_125531_c1 3300050514 Bacteria 1723
176 nmdc:mga0a205_205008_c1 3300050515 Bacteria 1861
177 nmdc:mga0a205_23273_c1 3300050515 Bacteria 5875
178 Ga0207682_10075297
179 JGI25405J52794_10038778
180 Ga0070676_10082625
181 Ga0070670_100059169
182 Ga0070660_100111443
183 Ga0070689_100267964
184 Ga0070675_100221952
185 Ga0070675_100396316
186 Ga0070675_100450501
187 Ga0070659_100105165
188 Ga0070667_100217084
189 Ga0070705_100221025
190 Ga0070708_100066423
191 Ga0070708_100093017
192 Ga0068867_100184048
193 Ga0068867_100267066
194 Ga0070698_100019122
195 Ga0070699_100007396
196 Ga0070697_100553520
197 Ga0070672_100180118
198 Ga0070695_100002211
199 Ga0070704_100313650
200 Ga0070704_100418494
201 Ga0068856_100187375
202 Ga0068859_100233067
203 Ga0068864_100117403
204 Ga0068861_100116615
205 Ga0068863_100089233
206 Ga0068863_100292509
207 Ga0068860_100119877
208 Ga0081455_10000341
209 Ga0081540_1000493
210 Ga0081539_10090146
211 Ga0070715_10018273
212 Ga0070715_10069774
213 Ga0075428_100009530
214 Ga0075428_100039961
215 Ga0075431_100005361
216 Ga0075431_100183707
217 Ga0075431_100253616
218 Ga0075431_100926649
219 Ga0075433_10001122
220 Ga0075433_10479671
221 Ga0075434_100001564
222 Ga0075434_100046069
223 Ga0075434_100075620
224 Ga0075429_100699171
225 Ga0075436_100051416
226 Ga0075436_100091502
227 Ga0097620_100233070
228 Ga0075435_100263167
229 Ga0111539_10009295
230 Ga0111539_10079576
231 Ga0111539_10112658
232 Ga0111539_10174088
233 Ga0111539_10299783
234 Ga0111539_10509623
235 Ga0114129_10320960
236 Ga0105243_10557567
237 Ga0105248_10217692
238 Ga0105248_10232935
239 Ga0163162_10219880
240 Ga0157375_10179925
241 Ga0157375_10671242
242 Ga0163163_10851982
243 Ga0163161_10074487
244 Ga0207685_10056210
245 Ga0207645_10096989
246 Ga0207646_10361526
247 Ga0207650_10490255
248 Ga0207659_10049414
249 Ga0207659_10299224
250 Ga0207687_10238320
251 Ga0207644_10513225
252 Ga0207690_10173269
253 Ga0207670_10469906
254 Ga0207691_10190642
255 Ga0207711_10557198
256 Ga0207651_10247369
257 Ga0207658_10142098
258 Ga0207658_10187229
259 Ga0207658_10632192
260 Ga0207678_10088951
261 Ga0207708_10026698
262 Ga0207708_10049403
263 Ga0207702_10239925
264 Ga0207641_10175354
265 Ga0207641_10345606
266 Ga0207648_10452393
267 Ga0207676_10111603
268 Ga0207675_100139957
269 Ga0207428_10005810
270 Ga0207428_10269843
271 Ga0268265_10071223
272 Ga0268265_10319370
273 Ga0268265_10532464
274 Ga0265338_10043444
275 Ga0265330_10024033
276 Ga0265330_10071234
277 Ga0265332_10000053
278 Ga0265332_10031626
279 Ga0265328_10004403
280 Ga0265320_10004760
281 Ga0265320_10024298
282 Ga0265325_10010705
283 Ga0265329_10035600
284 Ga0265339_10002655
285 Ga0265331_10000130
286 Ga0265331_10017344
287 Ga0265331_10067479
288 Ga0265316_10000085
289 Ga0265313_10078979
290 Ga0265314_10000254
291 Ga0265314_10000540
292 Ga0265342_10074947
293 Ga0316576_10121222
294 Ga0316578_10297743
295 Ga0373948_0009268
296 Ga0373950_0009332
297 Ga0373958_0006953
298 Ga0373959_0015262
299 Ga0373940_0004191
300 Ga0373949_0044430
301 Ga0373951_0014785
302 Ga0373939_0004653
303 Ga0373941_0035454
304 Ga0373961_0018860
305 Ga0373962_0009755
306 Ga0373962_0026599
307 Ga0316574_0029201
308 Ga0373931_0000330
309 Ga0373931_0013359
310 Ga0373935_0029665
311 Ga0373927_0070956
312 Ga0373947_0003907
313 Ga0373937_0310103
314 Ga0316584_0145460
315 Ga0373925_0019593
316 Ga0436361_1067640
317 Ga0439449_0130807
318 Ga0495629_0279766
319 Ga0495584_0054835
320 Ga0495640_0336020
321 Ga0495680_0149616
322 Ga0496102_0035634
323 Ga0496104_0628495
324 Ga0496105_0154432
325 Ga0496106_0148457
326 Ga0496109_0127354
327 Ga0496109_0455668
328 Ga0496110_0394213
329 Ga0496110_0541288
330 Ga0496112_0204985
331 Ga0496113_0148532
332 Ga0496115_0022670
333 Ga0501034_0277724
334 Ga0501073_0071646
335 nmdc:mga05p37_185076_c1
336 nmdc:mga05p37_318004_c1
337 nmdc:mga05p37_71730_c1
338 nmdc:mga06r32_12856_c1
339 nmdc:mga06r32_528199_c1
340 nmdc:mga06r32_94269_c1
341 nmdc:mga08y16_159063_c1
342 nmdc:mga08y16_473212_c1
343 nmdc:mga08y16_54709_c1
344 nmdc:mga08y16_638916_c1
345 nmdc:mga0n895_41606_c1
346 nmdc:mga0n895_453514_c1
347 nmdc:mga0n895_63858_c1
348 nmdc:mga0n895_7653_c1
349 nmdc:mga0rr50_321124_c1
350 nmdc:mga0rr50_431557_c1
351 nmdc:mga0rr50_449108_c1
352 nmdc:mga08x19_125531_c1
353 nmdc:mga0a205_205008_c1
354 nmdc:mga0a205_23273_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

30

103

0.95

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

34

98

0.94

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

29

97

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nv6-assembly2.cif.gz_B crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri with glutathione bound 0.8768 8 210
6nv6-assembly1.cif.gz_A crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri with glutathione bound 0.8711 8 210
6nxv-assembly1.cif.gz_A crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri, apo form 0.8603 8 211
6nv6-assembly3.cif.gz_C crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri with glutathione bound 0.8588 8 211
4kh7-assembly3.cif.gz_B crystal structure of a glutathione transferase family member from salmonella enterica ty2, target efi-507262, with bound glutathione 0.8583 4 211
ID Description Score Start End Superfamily
af_B6U5S1_5_83_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9371 8 87 3.40.30.10
3lykA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9355 9 85 3.40.30.10
af_Q9H4Y5_21_96_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9246 8 78 3.40.30.10
1yy7B01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.923 8 85 3.40.30.10
af_Q9VSL3_17_104_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9186 7 85 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7C2LYR3-F1-model_v4 Glutathione S-transferase family protein 0.993 4 251 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A7C2X3W8-F1-model_v4 GNAT family N-acetyltransferase 0.9831 8 250 GO:0016747
AF-A0A850SWE0-F1-model_v4 Glutathione S-transferase family protein 0.9815 8 250 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A7C2LYR3-F1-model_v4 Glutathione S-transferase family protein 0.9812 4 251 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A1I4LMC5-F1-model_v4 Glutathione S-transferase 0.9784 5 250 GO:0004364
GO:0006559
GO:0006749
GO:0016034

Map