F270198

General Info

Members Datasets Scaffolds Average Seq Length
177 143 354 146

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10056590|Ga0105246_100565902
Length 165
Sequence MMTATHTRPAHTAKQEWATGLTAFAAVMLFLVGLLDLFRGIMAIAEDDIFATTRNYVFEFDLTGWGWIHLALGVVAVIVSFGLLKTATWARVAGVAIAGLVIIANFLSLPYYPVWSVVMIAISGLIIWALCVVERGNLFDLSEERPMSEARPPDRTSYPYPHGPA

Samples

Sample ID Description Type Environment
1 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
11 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
20 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
21 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
22 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
23 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
32 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
33 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
34 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
35 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
36 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
37 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
38 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
39 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
40 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
41 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
42 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
43 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
44 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
45 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
46 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
47 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
48 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
49 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
50 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
51 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
52 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
53 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
54 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
55 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
56 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
57 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
58 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
59 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
60 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
61 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
62 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
63 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
64 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
65 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
66 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
67 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
68 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
69 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
70 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
71 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
72 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
73 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
74 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
75 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
76 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
77 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
78 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
79 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
80 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
94 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
95 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
98 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
99 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
100 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
101 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
108 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
109 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
110 2643221647 Streptomyces sp. Root369 Isolate Unclassified
111 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
112 2643221714 Streptomyces sp. Root264 Isolate Unclassified
113 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
114 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
115 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
116 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
117 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
118 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
119 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
120 2867428634 Streptomyces sp. RP5T Isolate Unclassified
121 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
122 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
123 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
124 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
125 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
126 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
127 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
128 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
129 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
130 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
131 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
132 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
133 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
134 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
135 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
136 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
137 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
138 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
139 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
140 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
141 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
142 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
143 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 71.19
Metatranscriptomes 7.91
Isolates 20.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.39
Nodule 1.13
Rhizoplane 2.26
Rhizosphere 71.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105246_10056590 3300011119 Bacteria 2711
2 JGI24737J22298_10035673 3300001990 Bacteria 1538
3 JGI24735J21928_10049571 3300002067 Bacteria 1213
4 JGI24738J21930_10017132 3300002075 Bacteria 1525
5 rootH1_10086080 3300003316 Bacteria 4175
6 rootH2_10090933 3300003320 Bacteria 1445
7 rootL2_10197655 3300003322 Bacteria 1207
8 rootL2_10254464 3300003322 Bacteria 2161
9 rootH1_10015381 3300003323 Bacteria 6859
10 rootH1_10058494 3300003323 Bacteria 4096
11 Ga0007427J51700_116112 3300003559 Bacteria 952
12 Ga0007427J51700_117238 3300003559 Bacteria 1016
13 Ga0006562J51391_1056925 3300003578 Bacteria 870
14 Ga0006562J51391_1161153 3300003578 Bacteria 843
15 Ga0007429J51699_1045786 3300003579 Bacteria 1113
16 Ga0058861_11465113 3300004800 Bacteria 781
17 Ga0070681_10742120 3300005458 Bacteria 898
18 Ga0068855_101096725 3300005563 Bacteria 832
19 Ga0068854_100863348 3300005578 Bacteria 793
20 Ga0068856_100427754 3300005614 Bacteria 1344
21 Ga0075363_100006997 3300006048 Bacteria 5158
22 Ga0075367_10674598 3300006178 Bacteria 657
23 Ga0099826_10056129 3300006948 Bacteria 2601
24 Ga0105243_10854681 3300009148 Bacteria 901
25 Ga0105246_10369565 3300011119 Bacteria 1181
26 Ga0157372_10664010 3300013307 Bacteria 1214
27 Ga0183367_1011 3300015688 Bacteria 397353
28 Ga0207647_10013615 3300025904 Bacteria 5631
29 Ga0207640_10817449 3300025981 Bacteria 808
30 Ga0207639_10337988 3300026041 Bacteria 1342
31 Ga0207678_10517324 3300026067 Bacteria 1041
32 Ga0207702_10370560 3300026078 Bacteria 1375
33 Ga0207683_11705542 3300026121 Bacteria 579
34 Ga0209371_1022414 3300027312 Bacteria 1509
35 Ga0268266_10216603 3300028379 Bacteria 1758
36 Ga0268256_1029291 3300030500 Bacteria 1348
37 Ga0307512_10007403 3300030522 Bacteria 10896
38 Ga0307508_10011922 3300031616 Bacteria 7949
39 Ga0307514_10008709 3300031649 Bacteria 8603
40 Ga0307516_10011565 3300031730 Bacteria 9577
41 Ga0307510_10032613 3300033180 Bacteria 5865
42 Ga0307510_10481106 3300033180 Bacteria 683
43 Ga0395898_0006800 3300037466 Bacteria 12165
44 Ga0439439_0015291 3300041406 Bacteria 1872
45 Ga0439439_0019792 3300041406 Bacteria 1672
46 Ga0451787_005296 3300041441 Bacteria 638
47 Ga0451791_0471434 3300041451 Bacteria 885
48 Ga0451797_0492181 3300041453 Bacteria 1364
49 Ga0451802_0917366 3300041460 Bacteria 527
50 Ga0451837_0122375 3300041494 Bacteria 1448
51 Ga0451839_0999828 3300041496 Bacteria 802
52 Ga0451841_1397959 3300041498 Bacteria 557
53 Ga0451845_0033528 3300041501 Bacteria 1374
54 Ga0451845_0735821 3300041501 Bacteria 1027
55 Ga0451849_1525626 3300041505 Bacteria 1047
56 Ga0451855_2048769 3300041511 Bacteria 662
57 Ga0451853_1812604 3300041512 Bacteria 1200
58 Ga0451853_3904236 3300041512 Bacteria 741
59 Ga0451853_3949282 3300041512 Bacteria 640
60 Ga0439431_0085384 3300041997 Bacteria 855
61 Ga0439433_0004038 3300041999 Bacteria 3157
62 Ga0439448_0163413 3300042005 Bacteria 775
63 Ga0439432_194472 3300042006 Bacteria 589
64 Ga0439449_0003791 3300042007 Bacteria 5849
65 Ga0439449_0063075 3300042007 Bacteria 1367
66 Ga0439449_0113647 3300042007 Bacteria 1003
67 Ga0439450_059649 3300042008 Bacteria 920
68 Ga0439455_0016326 3300042012 Bacteria 1716
69 Ga0439457_006513 3300042014 Bacteria 2858
70 Ga0450920_056389 3300042122 Bacteria 791
71 Ga0450894_005206 3300042131 Bacteria 1682
72 Ga0450896_003930 3300042133 Bacteria 1998
73 Ga0450898_002889 3300042134 Bacteria 2419
74 Ga0450903_000098 3300042138 Bacteria 18290
75 Ga0450903_000916 3300042138 Bacteria 5656
76 Ga0450903_035061 3300042138 Bacteria 751
77 Ga0450906_001191 3300042145 Bacteria 5753
78 Ga0439458_0009278 3300042157 Bacteria 2190
79 Ga0450901_014067 3300042533 Bacteria 840
80 Ga0466972_0001203 3300044658 Bacteria 12447
81 Ga0466965_0022430 3300044683 Bacteria 3043
82 Ga0466965_0118511 3300044683 Bacteria 1365
83 Ga0466961_0009688 3300044693 Bacteria 6130
84 Ga0466961_0302263 3300044693 Bacteria 977
85 Ga0466963_0005546 3300044694 Bacteria 7392
86 Ga0466963_0103003 3300044694 Bacteria 1955
87 Ga0466964_0006404 3300044706 Bacteria 4387
88 Ga0466964_0105343 3300044706 Bacteria 1250
89 Ga0466970_0005416 3300044765 Bacteria 6332
90 Ga0466970_0119937 3300044765 Bacteria 1440
91 Ga0466957_0000451 3300044842 Bacteria 20318
92 Ga0466960_0007099 3300044901 Bacteria 4529
93 Ga0466960_0753226 3300044901 Bacteria 587
94 Ga0466959_0041684 3300045049 Bacteria 3388
95 Ga0466958_0127138 3300045836 Bacteria 1598
96 Ga0466967_0029431 3300045976 Bacteria 4596
97 Ga0466967_0175400 3300045976 Bacteria 2019
98 Ga0466967_0225508 3300045976 Bacteria 1782
99 Ga0495625_0204197 3300046660 Bacteria 1302
100 Ga0495661_0459259 3300046665 Bacteria 612
101 Ga0495685_009965 3300047447 Bacteria 3181
102 Ga0501031_0031657 3300049568 Bacteria 3450
103 Ga0501032_0166054 3300049569 Bacteria 1448
104 Ga0501033_0030903 3300049570 Bacteria 4025
105 Ga0501034_0127514 3300049571 Bacteria 2529
106 Ga0501034_0330690 3300049571 Bacteria 1455
107 Ga0501036_0008245 3300049572 Bacteria 8541
108 Ga0501037_0016610 3300049573 Bacteria 5417
109 Ga0501037_0035055 3300049573 Bacteria 3701
110 Ga0501038_0063026 3300049574 Bacteria 3166
111 Ga0501039_0021403 3300049575 Bacteria 4962
112 Ga0501042_0031540 3300049578 Bacteria 3749
113 Ga0501043_0353292 3300049579 Bacteria 1116
114 Ga0501046_0006301 3300049580 Bacteria 10519
115 Ga0501046_0340288 3300049580 Bacteria 1090
116 Ga0501047_0003887 3300049581 Bacteria 14042
117 Ga0501047_0065037 3300049581 Bacteria 3516
118 Ga0501048_0011527 3300049582 Bacteria 6591
119 Ga0501048_0205055 3300049582 Bacteria 1398
120 Ga0501070_0181103 3300049586 Bacteria 1734
121 Ga0501070_0393413 3300049586 Bacteria 1122
122 Ga0501073_1217165 3300049589 Bacteria 517
123 Ga0501035_0173665 3300049822 Bacteria 1861
124 Ga0501035_0358776 3300049822 Bacteria 1218
125 Ga0501044_0058505 3300049823 Bacteria 3952
126 Ga0501044_0252137 3300049823 Bacteria 1705
127 Ga0501045_0509782 3300049824 Bacteria 893
128 nmdc:mga03n38_73062_c1 3300050490 Bacteria 1592
129 nmdc:mga03n38_92845_c1 3300050490 Bacteria 1440
130 nmdc:mga06z11_605469_c1 3300050494 Bacteria 666
131 nmdc:mga07m45_128763_c1 3300050496 Bacteria 1464
132 Ga0587073_0029720 3300059492 Bacteria 1119
133 Ga0587073_0108083 3300059492 Bacteria 733
134 Ga0587073_0234177 3300059492 Bacteria 568
135 Ga0587091_107526 3300059511 Bacteria 662
136 Ga0587099_047610 3300059622 Bacteria 565
137 Ga0587128_027990 3300059630 Bacteria 914
138 Ga0587072_188024 3300059643 Bacteria 519
139 Ga0587114_032762 3300059655 Bacteria 804
140 Ga0466962_0000432 3300061719 Bacteria 18182
141 2585304214 2582581313 Bacteria 10042643
142 2643946940 2643221587 Bacteria 7586415
143 2644262615 2643221647 Bacteria 10741251
144 2644435120 2643221677 Bacteria 7584031
145 2644629933 2643221714 Bacteria 9015452
146 2785373284 2784746768 Bacteria 10036182
147 2786674701 2786546132 Bacteria 10419719
148 2808847499 2808606359 Bacteria 9866990
149 2808918556 2808606375 Bacteria 9466072
150 2812353559 2811994879 Bacteria 9313447
151 2812354713 2811994879 Bacteria 9313447
152 2812477880 2811994917 Bacteria 7761064
153 2852642486 2852635781 Bacteria 8251373
154 2867430270 2867428634 Bacteria 9590268
155 2877677629 2877676314 Bacteria 9512378
156 2912726693 2912723979 Bacteria 8557534
157 2918501579 2918501144 Bacteria 8668083
158 2946069801 2946064051 Bacteria 8957905
159 2946073784 2946072368 Bacteria 8999607
160 2947228364 2947224130 Bacteria 9938529
161 2954004267 2954002825 Bacteria 9173742
162 2954385510 2954380949 Bacteria 10050426
163 2954680701 2954673503 Bacteria 9685905
164 2954683452 2954682443 Bacteria 9862841
165 2954696144 2954691527 Bacteria 10720516
166 2954711319 2954701450 Bacteria 10834262
167 2954712873 2954711539 Bacteria 10867210
168 2954722831 2954721474 Bacteria 10456478
169 2954738998 2954731030 Bacteria 10243860
170 2954741742 2954740390 Bacteria 10229294
171 2954757856 2954749733 Bacteria 10366972
172 2954760721 2954759201 Bacteria 9358192
173 2990067764 2990059506 Bacteria 9321252
174 8008560732 8008558824 Bacteria 10610750
175 8008580909 8008574985 Bacteria 7815457
176 8048411288 8048406513 Bacteria 8936924
177 8056836206 8056829672 Bacteria 9045328
178 Ga0105246_10056590
179 JGI24737J22298_10035673
180 JGI24735J21928_10049571
181 JGI24738J21930_10017132
182 rootH1_10086080
183 rootH2_10090933
184 rootL2_10197655
185 rootL2_10254464
186 rootH1_10015381
187 rootH1_10058494
188 Ga0007427J51700_116112
189 Ga0007427J51700_117238
190 Ga0006562J51391_1056925
191 Ga0006562J51391_1161153
192 Ga0007429J51699_1045786
193 Ga0058861_11465113
194 Ga0070681_10742120
195 Ga0068855_101096725
196 Ga0068854_100863348
197 Ga0068856_100427754
198 Ga0075363_100006997
199 Ga0075367_10674598
200 Ga0099826_10056129
201 Ga0105243_10854681
202 Ga0105246_10369565
203 Ga0157372_10664010
204 Ga0183367_1011
205 Ga0207647_10013615
206 Ga0207640_10817449
207 Ga0207639_10337988
208 Ga0207678_10517324
209 Ga0207702_10370560
210 Ga0207683_11705542
211 Ga0209371_1022414
212 Ga0268266_10216603
213 Ga0268256_1029291
214 Ga0307512_10007403
215 Ga0307508_10011922
216 Ga0307514_10008709
217 Ga0307516_10011565
218 Ga0307510_10032613
219 Ga0307510_10481106
220 Ga0395898_0006800
221 Ga0439439_0015291
222 Ga0439439_0019792
223 Ga0451787_005296
224 Ga0451791_0471434
225 Ga0451797_0492181
226 Ga0451802_0917366
227 Ga0451837_0122375
228 Ga0451839_0999828
229 Ga0451841_1397959
230 Ga0451845_0033528
231 Ga0451845_0735821
232 Ga0451849_1525626
233 Ga0451855_2048769
234 Ga0451853_1812604
235 Ga0451853_3904236
236 Ga0451853_3949282
237 Ga0439431_0085384
238 Ga0439433_0004038
239 Ga0439448_0163413
240 Ga0439432_194472
241 Ga0439449_0003791
242 Ga0439449_0063075
243 Ga0439449_0113647
244 Ga0439450_059649
245 Ga0439455_0016326
246 Ga0439457_006513
247 Ga0450920_056389
248 Ga0450894_005206
249 Ga0450896_003930
250 Ga0450898_002889
251 Ga0450903_000098
252 Ga0450903_000916
253 Ga0450903_035061
254 Ga0450906_001191
255 Ga0439458_0009278
256 Ga0450901_014067
257 Ga0466972_0001203
258 Ga0466965_0022430
259 Ga0466965_0118511
260 Ga0466961_0009688
261 Ga0466961_0302263
262 Ga0466963_0005546
263 Ga0466963_0103003
264 Ga0466964_0006404
265 Ga0466964_0105343
266 Ga0466970_0005416
267 Ga0466970_0119937
268 Ga0466957_0000451
269 Ga0466960_0007099
270 Ga0466960_0753226
271 Ga0466959_0041684
272 Ga0466958_0127138
273 Ga0466967_0029431
274 Ga0466967_0175400
275 Ga0466967_0225508
276 Ga0495625_0204197
277 Ga0495661_0459259
278 Ga0495685_009965
279 Ga0501031_0031657
280 Ga0501032_0166054
281 Ga0501033_0030903
282 Ga0501034_0127514
283 Ga0501034_0330690
284 Ga0501036_0008245
285 Ga0501037_0016610
286 Ga0501037_0035055
287 Ga0501038_0063026
288 Ga0501039_0021403
289 Ga0501042_0031540
290 Ga0501043_0353292
291 Ga0501046_0006301
292 Ga0501046_0340288
293 Ga0501047_0003887
294 Ga0501047_0065037
295 Ga0501048_0011527
296 Ga0501048_0205055
297 Ga0501070_0181103
298 Ga0501070_0393413
299 Ga0501073_1217165
300 Ga0501035_0173665
301 Ga0501035_0358776
302 Ga0501044_0058505
303 Ga0501044_0252137
304 Ga0501045_0509782
305 nmdc:mga03n38_73062_c1
306 nmdc:mga03n38_92845_c1
307 nmdc:mga06z11_605469_c1
308 nmdc:mga07m45_128763_c1
309 Ga0587073_0029720
310 Ga0587073_0108083
311 Ga0587073_0234177
312 Ga0587091_107526
313 Ga0587099_047610
314 Ga0587128_027990
315 Ga0587072_188024
316 Ga0587114_032762
317 Ga0466962_0000432
318 2585304214
319 2643946940
320 2644262615
321 2644435120
322 2644629933
323 2785373284
324 2786674701
325 2808847499
326 2808918556
327 2812353559
328 2812354713
329 2812477880
330 2852642486
331 2867430270
332 2877677629
333 2912726693
334 2918501579
335 2946069801
336 2946073784
337 2947228364
338 2954004267
339 2954385510
340 2954680701
341 2954683452
342 2954696144
343 2954711319
344 2954712873
345 2954722831
346 2954738998
347 2954741742
348 2954757856
349 2954760721
350 2990067764
351 8008560732
352 8008580909
353 8048411288
354 8056836206

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF23636

21

135

0.98

Map