F270100

General Info

Members Datasets Scaffolds Average Seq Length
177 48 354 293

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10287625|Ga0105240_102876251
Length 296
Sequence MSDTTASLSRKIRSAGDLQSVVRTMKAVAASSIGQYEKSVRALGDYYRTVELGLSACFRELAPAAPVDGRDRSDDGPIGAIVFGSDQGLVGQFNETLADFAIKILAGLSGKPHVWAVGERVYERLADAGLPMMGLFPVPNSVKGIAPLVSQIQIESEGRRAGGDYARVYVFHQRPLAGSLCEPVSQRLLPLDAEWQRDLAKVTWPTGNLPEVMGTGADTLRALIREYLFISLFRACAESLASENASRLAAMDRAERNIDELSEELNRRFHRLRQSSIDEELFDVISGFEALSKPAR

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
6 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
7 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
8 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
9 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
10 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
11 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
12 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
13 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
14 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
15 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
16 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
17 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
18 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
19 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
20 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
21 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
22 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
23 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
24 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
25 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
26 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
27 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
28 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
29 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
30 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
31 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
32 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
33 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
34 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
35 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
36 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
37 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
38 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
39 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
40 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
41 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
42 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
43 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
44 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
45 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
46 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
47 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
48 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.39
Nodule 0
Rhizoplane 1.13
Rhizosphere 95.48
Stem 0
Stem Tuber 0
Unclassified 4.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10287625 3300009093 Bacteria 1886
2 Ga0070689_100361155 3300005340 Bacteria 1220
3 Ga0070714_100025406 3300005435 Bacteria 4888
4 Ga0070713_100401047 3300005436 Bacteria 1281
5 Ga0070694_100127817 3300005444 Bacteria 1832
6 Ga0070686_100008871 3300005544 Bacteria 5636
7 Ga0075370_10001023 3300006353 Bacteria 11616
8 Ga0207650_10240235 3300025925 Bacteria 1464
9 Ga0207664_10020246 3300025929 Bacteria 4928
10 Ga0265337_1000383 3300028556 Bacteria 23777
11 Ga0265337_1006060 3300028556 Bacteria 4712
12 Ga0265337_1007039 3300028556 Bacteria 4251
13 Ga0265337_1020974 3300028556 Bacteria 2041
14 Ga0265326_10004003 3300028558 Bacteria 4771
15 Ga0265326_10009013 3300028558 Bacteria 2989
16 Ga0265326_10011215 3300028558 Bacteria 2645
17 Ga0265326_10011369 3300028558 Bacteria 2625
18 Ga0265326_10015460 3300028558 Bacteria 2214
19 Ga0265326_10015834 3300028558 Bacteria 2183
20 Ga0265326_10016655 3300028558 Bacteria 2123
21 Ga0265319_1000075 3300028563 Bacteria 77601
22 Ga0265319_1000702 3300028563 Bacteria 21859
23 Ga0265319_1017207 3300028563 Bacteria 2754
24 Ga0265319_1017501 3300028563 Bacteria 2724
25 Ga0265319_1023773 3300028563 Bacteria 2215
26 Ga0265334_10000395 3300028573 Bacteria 23023
27 Ga0265334_10020806 3300028573 Bacteria 2683
28 Ga0265334_10042747 3300028573 Bacteria 1765
29 Ga0265318_10000101 3300028577 Bacteria 79709
30 Ga0265318_10001281 3300028577 Bacteria 15145
31 Ga0265318_10001989 3300028577 Bacteria 11346
32 Ga0265318_10056381 3300028577 Bacteria 1469
33 Ga0265318_10103170 3300028577 Bacteria 1049
34 Ga0265323_10000006 3300028653 Bacteria 141508
35 Ga0265323_10001740 3300028653 Bacteria 10325
36 Ga0265323_10003218 3300028653 Bacteria 7273
37 Ga0265323_10005333 3300028653 Bacteria 5465
38 Ga0265323_10026130 3300028653 Bacteria 2203
39 Ga0265323_10031866 3300028653 Bacteria 1957
40 Ga0265323_10055069 3300028653 Unclassified 1400
41 Ga0265322_10001471 3300028654 Bacteria 7670
42 Ga0265322_10002457 3300028654 Bacteria 5714
43 Ga0265322_10005249 3300028654 Bacteria 3834
44 Ga0265336_10000653 3300028666 Bacteria 18863
45 Ga0265336_10017275 3300028666 Unclassified 2351
46 Ga0265338_10000096 3300028800 Bacteria 164859
47 Ga0265338_10000242 3300028800 Bacteria 101378
48 Ga0265338_10000269 3300028800 Bacteria 95081
49 Ga0265338_10000834 3300028800 Bacteria 51995
50 Ga0265338_10001253 3300028800 Bacteria 41843
51 Ga0265338_10001791 3300028800 Bacteria 33837
52 Ga0265338_10002532 3300028800 Bacteria 27094
53 Ga0265338_10003109 3300028800 Bacteria 23752
54 Ga0265338_10008746 3300028800 Bacteria 12239
55 Ga0265338_10016103 3300028800 Bacteria 8158
56 Ga0265338_10017669 3300028800 Bacteria 7672
57 Ga0265338_10022307 3300028800 Bacteria 6559
58 Ga0265338_10022723 3300028800 Bacteria 6478
59 Ga0265338_10027863 3300028800 Bacteria 5653
60 Ga0265338_10028854 3300028800 Bacteria 5521
61 Ga0265338_10037991 3300028800 Unclassified 4571
62 Ga0265338_10053491 3300028800 Bacteria 3611
63 Ga0265338_10075140 3300028800 Bacteria 2869
64 Ga0265338_10103494 3300028800 Bacteria 2312
65 Ga0265338_10267328 3300028800 Bacteria 1255
66 Ga0265324_10000060 3300029957 Bacteria 92715
67 Ga0265324_10000996 3300029957 Bacteria 17416
68 Ga0265324_10001057 3300029957 Bacteria 16738
69 Ga0265324_10002549 3300029957 Bacteria 9211
70 Ga0265324_10052190 3300029957 Bacteria 1404
71 Ga0265330_10000238 3300031235 Bacteria 41537
72 Ga0265330_10007696 3300031235 Bacteria 5232
73 Ga0265330_10009767 3300031235 Bacteria 4546
74 Ga0265330_10014312 3300031235 Bacteria 3682
75 Ga0265330_10138623 3300031235 Unclassified 1034
76 Ga0265332_10016701 3300031238 Bacteria 3239
77 Ga0265332_10024936 3300031238 Bacteria 2629
78 Ga0265332_10135602 3300031238 Unclassified 1032
79 Ga0265328_10002072 3300031239 Bacteria 9054
80 Ga0265328_10015221 3300031239 Bacteria 3018
81 Ga0265320_10000329 3300031240 Bacteria 38767
82 Ga0265320_10006277 3300031240 Bacteria 7512
83 Ga0265320_10014713 3300031240 Bacteria 4442
84 Ga0265320_10015510 3300031240 Bacteria 4305
85 Ga0265320_10030708 3300031240 Bacteria 2767
86 Ga0265320_10044442 3300031240 Unclassified 2188
87 Ga0265325_10000752 3300031241 Bacteria 23441
88 Ga0265325_10001616 3300031241 Bacteria 15715
89 Ga0265325_10027937 3300031241 Bacteria 3046
90 Ga0265325_10057575 3300031241 Bacteria 1982
91 Ga0265325_10109692 3300031241 Bacteria 1342
92 Ga0265329_10000555 3300031242 Bacteria 19303
93 Ga0265329_10001900 3300031242 Bacteria 9847
94 Ga0265329_10009567 3300031242 Bacteria 3606
95 Ga0265329_10025543 3300031242 Unclassified 1953
96 Ga0265340_10001328 3300031247 Bacteria 14166
97 Ga0265340_10007817 3300031247 Bacteria 5799
98 Ga0265340_10022885 3300031247 Bacteria 3190
99 Ga0265339_10000063 3300031249 Bacteria 93016
100 Ga0265339_10000596 3300031249 Bacteria 28116
101 Ga0265339_10012692 3300031249 Bacteria 5128
102 Ga0265339_10021544 3300031249 Bacteria 3748
103 Ga0265339_10024780 3300031249 Bacteria 3453
104 Ga0265339_10027673 3300031249 Bacteria 3231
105 Ga0265339_10093562 3300031249 Bacteria 1572
106 Ga0265331_10000175 3300031250 Bacteria 78849
107 Ga0265331_10008996 3300031250 Bacteria 5643
108 Ga0265331_10036702 3300031250 Bacteria 2405
109 Ga0265331_10068102 3300031250 Bacteria 1669
110 Ga0265327_10020709 3300031251 Bacteria 3996
111 Ga0265327_10026849 3300031251 Bacteria 3326
112 Ga0265327_10045517 3300031251 Bacteria 2331
113 Ga0265327_10048607 3300031251 Bacteria 2230
114 Ga0265316_10002068 3300031344 Bacteria 21125
115 Ga0265316_10006651 3300031344 Bacteria 11010
116 Ga0265316_10014764 3300031344 Bacteria 6856
117 Ga0265316_10026047 3300031344 Bacteria 4872
118 Ga0265316_10038810 3300031344 Bacteria 3831
119 Ga0265316_10040059 3300031344 Bacteria 3758
120 Ga0265316_10045380 3300031344 Bacteria 3489
121 Ga0265316_10048738 3300031344 Bacteria 3341
122 Ga0265316_10094132 3300031344 Bacteria 2282
123 Ga0265316_10105783 3300031344 Unclassified 2135
124 Ga0265316_10112498 3300031344 Bacteria 2061
125 Ga0265316_10122390 3300031344 Bacteria 1964
126 Ga0265316_10130671 3300031344 Bacteria 1891
127 Ga0265316_10258403 3300031344 Bacteria 1277
128 Ga0265316_10264505 3300031344 Bacteria 1260
129 Ga0265316_10399510 3300031344 Bacteria 990
130 Ga0265313_10000944 3300031595 Bacteria 28854
131 Ga0265313_10002044 3300031595 Bacteria 18103
132 Ga0265313_10002175 3300031595 Bacteria 17382
133 Ga0265313_10012947 3300031595 Bacteria 5053
134 Ga0265313_10016821 3300031595 Bacteria 4191
135 Ga0265313_10022259 3300031595 Bacteria 3443
136 Ga0265313_10069500 3300031595 Bacteria 1625
137 Ga0265313_10083774 3300031595 Bacteria 1443
138 Ga0265313_10113279 3300031595 Bacteria 1190
139 Ga0265314_10000304 3300031711 Bacteria 70430
140 Ga0265314_10000310 3300031711 Bacteria 69421
141 Ga0265314_10001033 3300031711 Bacteria 32400
142 Ga0265314_10001130 3300031711 Bacteria 30899
143 Ga0265314_10002169 3300031711 Bacteria 20535
144 Ga0265314_10010081 3300031711 Bacteria 7922
145 Ga0265314_10023006 3300031711 Bacteria 4763
146 Ga0265314_10044342 3300031711 Bacteria 3153
147 Ga0265342_10001611 3300031712 Bacteria 20844
148 Ga0265342_10005263 3300031712 Bacteria 9918
149 Ga0265342_10008458 3300031712 Bacteria 7371
150 Ga0265342_10011535 3300031712 Bacteria 6040
151 Ga0265342_10019910 3300031712 Bacteria 4316
152 Ga0265342_10024593 3300031712 Bacteria 3800
153 Ga0265342_10037465 3300031712 Bacteria 2957
154 Ga0265342_10042980 3300031712 Bacteria 2728
155 Ga0265342_10101956 3300031712 Bacteria 1633
156 Ga0265342_10106136 3300031712 Bacteria 1594
157 Ga0265342_10115394 3300031712 Bacteria 1516
158 Ga0373947_0070008 3300035725 Bacteria 2149
159 Ga0373937_0017700 3300036401 Bacteria 6357
160 Ga0373937_0060555 3300036401 Bacteria 3479
161 Ga0373937_0233568 3300036401 Bacteria 1732
162 Ga0373937_0269750 3300036401 Bacteria 1606
163 Ga0373937_0375979 3300036401 Bacteria 1347
164 Ga0451577_0002811 3300042876 Bacteria 20063
165 Ga0451576_0013011 3300045051 Bacteria 9321
166 Ga0495651_0074653 3300046462 Bacteria 2572
167 Ga0495587_0153952 3300046536 Bacteria 1310
168 Ga0495604_0159527 3300047317 Bacteria 1595
169 Ga0495604_0315561 3300047317 Bacteria 1046
170 Ga0496106_0395055 3300048909 Bacteria 1111
171 Ga0496114_0107740 3300048917 Bacteria 2385
172 Ga0501044_0073831 3300049823 Bacteria 3466
173 nmdc:mga07m45_369_c1 3300050496 Bacteria 18430
174 Ga0500555_000274 3300053103 Bacteria 22271
175 Ga0500556_0000177 3300053104 Bacteria 52500
176 Ga0500642_0001638 3300053130 Bacteria 6460
177 Ga0500559_0019301 3300053136 Bacteria 2881
178 Ga0105240_10287625
179 Ga0070689_100361155
180 Ga0070714_100025406
181 Ga0070713_100401047
182 Ga0070694_100127817
183 Ga0070686_100008871
184 Ga0075370_10001023
185 Ga0207650_10240235
186 Ga0207664_10020246
187 Ga0265337_1000383
188 Ga0265337_1006060
189 Ga0265337_1007039
190 Ga0265337_1020974
191 Ga0265326_10004003
192 Ga0265326_10009013
193 Ga0265326_10011215
194 Ga0265326_10011369
195 Ga0265326_10015460
196 Ga0265326_10015834
197 Ga0265326_10016655
198 Ga0265319_1000075
199 Ga0265319_1000702
200 Ga0265319_1017207
201 Ga0265319_1017501
202 Ga0265319_1023773
203 Ga0265334_10000395
204 Ga0265334_10020806
205 Ga0265334_10042747
206 Ga0265318_10000101
207 Ga0265318_10001281
208 Ga0265318_10001989
209 Ga0265318_10056381
210 Ga0265318_10103170
211 Ga0265323_10000006
212 Ga0265323_10001740
213 Ga0265323_10003218
214 Ga0265323_10005333
215 Ga0265323_10026130
216 Ga0265323_10031866
217 Ga0265323_10055069
218 Ga0265322_10001471
219 Ga0265322_10002457
220 Ga0265322_10005249
221 Ga0265336_10000653
222 Ga0265336_10017275
223 Ga0265338_10000096
224 Ga0265338_10000242
225 Ga0265338_10000269
226 Ga0265338_10000834
227 Ga0265338_10001253
228 Ga0265338_10001791
229 Ga0265338_10002532
230 Ga0265338_10003109
231 Ga0265338_10008746
232 Ga0265338_10016103
233 Ga0265338_10017669
234 Ga0265338_10022307
235 Ga0265338_10022723
236 Ga0265338_10027863
237 Ga0265338_10028854
238 Ga0265338_10037991
239 Ga0265338_10053491
240 Ga0265338_10075140
241 Ga0265338_10103494
242 Ga0265338_10267328
243 Ga0265324_10000060
244 Ga0265324_10000996
245 Ga0265324_10001057
246 Ga0265324_10002549
247 Ga0265324_10052190
248 Ga0265330_10000238
249 Ga0265330_10007696
250 Ga0265330_10009767
251 Ga0265330_10014312
252 Ga0265330_10138623
253 Ga0265332_10016701
254 Ga0265332_10024936
255 Ga0265332_10135602
256 Ga0265328_10002072
257 Ga0265328_10015221
258 Ga0265320_10000329
259 Ga0265320_10006277
260 Ga0265320_10014713
261 Ga0265320_10015510
262 Ga0265320_10030708
263 Ga0265320_10044442
264 Ga0265325_10000752
265 Ga0265325_10001616
266 Ga0265325_10027937
267 Ga0265325_10057575
268 Ga0265325_10109692
269 Ga0265329_10000555
270 Ga0265329_10001900
271 Ga0265329_10009567
272 Ga0265329_10025543
273 Ga0265340_10001328
274 Ga0265340_10007817
275 Ga0265340_10022885
276 Ga0265339_10000063
277 Ga0265339_10000596
278 Ga0265339_10012692
279 Ga0265339_10021544
280 Ga0265339_10024780
281 Ga0265339_10027673
282 Ga0265339_10093562
283 Ga0265331_10000175
284 Ga0265331_10008996
285 Ga0265331_10036702
286 Ga0265331_10068102
287 Ga0265327_10020709
288 Ga0265327_10026849
289 Ga0265327_10045517
290 Ga0265327_10048607
291 Ga0265316_10002068
292 Ga0265316_10006651
293 Ga0265316_10014764
294 Ga0265316_10026047
295 Ga0265316_10038810
296 Ga0265316_10040059
297 Ga0265316_10045380
298 Ga0265316_10048738
299 Ga0265316_10094132
300 Ga0265316_10105783
301 Ga0265316_10112498
302 Ga0265316_10122390
303 Ga0265316_10130671
304 Ga0265316_10258403
305 Ga0265316_10264505
306 Ga0265316_10399510
307 Ga0265313_10000944
308 Ga0265313_10002044
309 Ga0265313_10002175
310 Ga0265313_10012947
311 Ga0265313_10016821
312 Ga0265313_10022259
313 Ga0265313_10069500
314 Ga0265313_10083774
315 Ga0265313_10113279
316 Ga0265314_10000304
317 Ga0265314_10000310
318 Ga0265314_10001033
319 Ga0265314_10001130
320 Ga0265314_10002169
321 Ga0265314_10010081
322 Ga0265314_10023006
323 Ga0265314_10044342
324 Ga0265342_10001611
325 Ga0265342_10005263
326 Ga0265342_10008458
327 Ga0265342_10011535
328 Ga0265342_10019910
329 Ga0265342_10024593
330 Ga0265342_10037465
331 Ga0265342_10042980
332 Ga0265342_10101956
333 Ga0265342_10106136
334 Ga0265342_10115394
335 Ga0373947_0070008
336 Ga0373937_0017700
337 Ga0373937_0060555
338 Ga0373937_0233568
339 Ga0373937_0269750
340 Ga0373937_0375979
341 Ga0451577_0002811
342 Ga0451576_0013011
343 Ga0495651_0074653
344 Ga0495587_0153952
345 Ga0495604_0159527
346 Ga0495604_0315561
347 Ga0496106_0395055
348 Ga0496114_0107740
349 Ga0501044_0073831
350 nmdc:mga07m45_369_c1
351 Ga0500555_000274
352 Ga0500556_0000177
353 Ga0500642_0001638
354 Ga0500559_0019301

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00231

ATP-synt

ATP synthase

4

291

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hkk-assembly2.cif.gz_O caldalaklibacillus thermarum f1-atpase (wild type) 0.8136 5 292
5hkk-assembly2.cif.gz_O caldalaklibacillus thermarum f1-atpase (wild type) 0.806 5 292
6vmd-assembly1.cif.gz_g chloroplast atp synthase (c1, cf1) 0.7883 3 291
1fs0-assembly1.cif.gz_G complex of gamma/epsilon atp synthase from e.coli 0.7834 21 252
1fs0-assembly1.cif.gz_G complex of gamma/epsilon atp synthase from e.coli 0.7739 21 252
ID Description Score Start End Superfamily
af_Q2FWE9_9_222_3.40.1380.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.8032 35 248 3.40.1380.10
af_I1KY89_89_218_3.40.1380.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.7924 71 193 3.40.1380.10
af_Q2FWE9_9_222_3.40.1380.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.7861 35 248 3.40.1380.10
1fs0G01 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.7692 67 193 3.40.1380.10
5dn6G02 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.7688 29 248 3.40.1380.10
ID Description Score Start End GO Terms
AF-A0A558IE38-F1-model_v4 deleted 0.9066 6 253
AF-H8Z6N5-F1-model_v4 F0F1-type ATP synthase, gamma subunit 0.8948 1 303 GO:0045261
GO:0046933
AF-A0A3D2NNV2-F1-model_v4 F0F1 ATP synthase subunit gamma 0.8928 6 233 GO:0045261
GO:0046933
AF-H8Z6N5-F1-model_v4 F0F1-type ATP synthase, gamma subunit 0.892 1 303 GO:0045261
GO:0046933
AF-Q1K2D3-F1-model_v4 H+-transporting two-sector ATPase, gamma subunit 0.8862 1 295 GO:0045261
GO:0046933

Map