F269370

General Info

Members Datasets Scaffolds Average Seq Length
177 117 354 159

Family's Representative Sequence

Representative Sequence 3300003187|JGI25151J46595_10013899|JGI25151J46595_100138992
Length 173
Sequence VILNGGMTMLALIEKVDNGYVAQFNRPLHYSVEQVWAVLTENEKLKRWMPNLYIEDLRQGGKIKFDMMDGSGEFINIDILRCQINSVLEFTWGEDRVRFEIHKDQENCLLILKEFIHEINDHTPKDLSGWHVCLEIFSSVLDDTEMEFPKEEWERWYKRYELVMDKIKNERVN

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
4 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
7 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
8 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
9 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
10 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
11 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
12 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
13 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
14 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
15 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
16 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
17 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
18 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
19 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
20 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
24 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
25 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
26 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
27 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
28 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
29 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
30 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
31 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
32 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
33 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
34 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
35 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
36 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
37 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
38 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
39 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
40 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
41 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
42 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
43 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
44 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
45 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
46 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
47 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
48 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
49 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
50 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
51 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
52 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
53 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
56 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
57 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
58 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
59 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
60 2643221729 Bacillus sp. Root11 Isolate Unclassified
61 2643221730 Bacillus sp. Root131 Isolate Unclassified
62 2684622632 Bacillus cereus 905 Isolate Unclassified
63 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
64 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
65 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
66 2738541295 Bacillus sp. OK085 Isolate Unclassified
67 2738541358 Bacillus sp. OV752 Isolate Unclassified
68 2738543006 Bacillus sp. OK077 Isolate Unclassified
69 2738543010 Bacillus sp. YR335 Isolate Unclassified
70 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
71 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
72 2818991459 Paenibacillus sp. 597 Isolate Unclassified
73 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
74 2857472729 Cohnella sp. R-74144 Isolate Unclassified
75 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
76 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
77 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
78 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
79 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
80 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
81 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
82 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
83 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
84 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
85 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
86 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
87 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
88 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
89 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
90 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
91 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
92 2938917290 Bacillus sp. CR71 Isolate Unclassified
93 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
94 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
95 2965761152 Bacillus sp. COPE52 Isolate Unclassified
96 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
97 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
98 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
99 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
100 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
101 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
102 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
103 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
104 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
105 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
106 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
107 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
108 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
109 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
110 8022792930 Bacillus sp. Xin Isolate Rhizosphere
111 8023438354 Bacillus sp. BH2 Isolate Unclassified
112 8023444577 Bacillus sp. BH32 Isolate Unclassified
113 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
114 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
115 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
116 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
117 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 64.41
Metatranscriptomes 1.13
Isolates 34.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.55
Nodule 0
Rhizoplane 12.43
Rhizosphere 37.85
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10013899 3300003187 Bacteria 3608
2 JGI25159J45721_1000208 3300002987 Bacteria 27474
3 JGI25151J46595_10005321 3300003187 Bacteria 6662
4 JGI25151J46595_10011662 3300003187 Bacteria 4030
5 JGI25151J46595_10012042 3300003187 Bacteria 3946
6 JGI25151J46595_10014221 3300003187 Bacteria 3552
7 JGI25151J46595_10016682 3300003187 Bacteria 3205
8 JGI25151J46595_10023659 3300003187 Bacteria 2525
9 JGI25151J46595_10026995 3300003187 Bacteria 2309
10 JGI25151J46595_10030500 3300003187 Bacteria 2120
11 JGI25151J46595_10032172 3300003187 Bacteria 2037
12 JGI25151J46595_10032864 3300003187 Bacteria 2005
13 JGI25151J46595_10086809 3300003187 Bacteria 885
14 Ga0055538_1000104 3300003751 Bacteria 67342
15 Ga0055538_1000142 3300003751 Bacteria 50402
16 Ga0055532_1000562 3300003758 Bacteria 15685
17 Ga0055536_1011783 3300003781 Bacteria 3307
18 Ga0105251_10008407 3300009011 Bacteria 6214
19 Ga0105251_10033143 3300009011 Bacteria 2568
20 Ga0105251_10168928 3300009011 Bacteria 985
21 Ga0105244_10008973 3300009036 Bacteria 6188
22 Ga0105244_10013933 3300009036 Bacteria 4672
23 Ga0105244_10020275 3300009036 Bacteria 3696
24 Ga0105250_10003134 3300009092 Bacteria 7948
25 Ga0105250_10005181 3300009092 Bacteria 5881
26 Ga0105250_10019998 3300009092 Bacteria 2707
27 Ga0105250_10020675 3300009092 Bacteria 2659
28 Ga0105250_10120010 3300009092 Bacteria 1080
29 Ga0105250_10434744 3300009092 Bacteria 587
30 Ga0105246_11102294 3300011119 Bacteria 725
31 Ga0157374_10151906 3300013296 Bacteria 2251
32 Ga0157374_10175408 3300013296 Bacteria 2092
33 Ga0157376_12173218 3300014969 Bacteria 594
34 Ga0209784_100038 3300025224 Bacteria 253212
35 Ga0209784_100129 3300025224 Bacteria 76203
36 Ga0209784_102263 3300025224 Bacteria 2025
37 Ga0209566_103636 3300025225 Bacteria 2299
38 Ga0209147_100115 3300025229 Bacteria 143934
39 Ga0209673_1039540 3300025273 Bacteria 1360
40 Ga0209673_1046303 3300025273 Bacteria 1188
41 Ga0209130_1000388 3300025284 Bacteria 48524
42 Ga0209130_1005375 3300025284 Bacteria 4463
43 Ga0209130_1023560 3300025284 Bacteria 1356
44 Ga0209130_1075482 3300025284 Bacteria 553
45 Ga0209675_1013588 3300025291 Bacteria 2533
46 Ga0209675_1029618 3300025291 Bacteria 1316
47 Ga0209676_1000983 3300025292 Bacteria 34049
48 Ga0209676_1006638 3300025292 Bacteria 5650
49 Ga0209676_1011413 3300025292 Bacteria 3585
50 Ga0209025_1000605 3300025294 Bacteria 64581
51 Ga0209025_1001708 3300025294 Bacteria 26734
52 Ga0209025_1001873 3300025294 Bacteria 24642
53 Ga0209025_1001969 3300025294 Bacteria 23633
54 Ga0209025_1002578 3300025294 Bacteria 18813
55 Ga0209025_1004141 3300025294 Bacteria 12878
56 Ga0209025_1004143 3300025294 Bacteria 12869
57 Ga0209025_1004583 3300025294 Bacteria 11858
58 Ga0209025_1006042 3300025294 Bacteria 9577
59 Ga0209025_1007993 3300025294 Bacteria 7722
60 Ga0209025_1019033 3300025294 Bacteria 3843
61 Ga0209025_1026122 3300025294 Bacteria 2943
62 Ga0209025_1029869 3300025294 Bacteria 2624
63 Ga0209025_1045060 3300025294 Bacteria 1834
64 Ga0207696_1003064 3300025711 Bacteria 7796
65 Ga0207696_1004131 3300025711 Bacteria 6347
66 Ga0207696_1018700 3300025711 Bacteria 2270
67 Ga0207696_1042812 3300025711 Bacteria 1319
68 Ga0207655_1002587 3300025728 Bacteria 14420
69 Ga0207655_1025144 3300025728 Bacteria 2898
70 Ga0207655_1083285 3300025728 Bacteria 1147
71 Ga0207713_1004192 3300025735 Bacteria 9454
72 Ga0207713_1015116 3300025735 Bacteria 3976
73 Ga0237817_10070 3300030083 Bacteria 32720
74 Ga0237817_10362 3300030083 Bacteria 8158
75 Ga0307405_10054896 3300031731 Bacteria 2490
76 Ga0307410_10283425 3300031852 Bacteria 1301
77 Ga0307406_10348133 3300031901 Bacteria 1157
78 Ga0307412_10565765 3300031911 Bacteria 957
79 Ga0307409_100173904 3300031995 Bacteria 1898
80 Ga0307416_100011589 3300032002 Bacteria 5890
81 Ga0373935_0935805 3300035692 Bacteria 643
82 Ga0373927_0660911 3300035695 Bacteria 691
83 Ga0237819_00167 3300038705 Bacteria 24178
84 Ga0237819_01321 3300038705 Bacteria 6625
85 Ga0466967_0000646 3300045976 Bacteria 17509
86 Ga0496100_0002572 3300048903 Bacteria 9242
87 Ga0496100_0311584 3300048903 Bacteria 1180
88 Ga0496101_0005478 3300048904 Bacteria 8094
89 Ga0496101_0248135 3300048904 Bacteria 1387
90 Ga0496102_0063547 3300048905 Bacteria 3380
91 Ga0496102_0063703 3300048905 Bacteria 3376
92 Ga0496103_0052994 3300048906 Bacteria 2513
93 Ga0496103_0069177 3300048906 Bacteria 2206
94 Ga0496104_0010120 3300048907 Bacteria 8421
95 Ga0496105_0006112 3300048908 Bacteria 9218
96 Ga0496106_0080851 3300048909 Bacteria 2496
97 Ga0496107_0003058 3300048910 Bacteria 11098
98 Ga0496107_0080274 3300048910 Bacteria 2379
99 Ga0496108_0197921 3300048911 Bacteria 1743
100 Ga0496109_0042821 3300048912 Bacteria 4103
101 Ga0496110_0000919 3300048913 Bacteria 20636
102 Ga0496110_0017190 3300048913 Bacteria 6047
103 Ga0496110_1594738 3300048913 Bacteria 563
104 Ga0496111_0001161 3300048914 Bacteria 14644
105 Ga0496111_0011673 3300048914 Bacteria 5928
106 Ga0496112_0008675 3300048915 Bacteria 9115
107 Ga0496113_0097224 3300048916 Bacteria 2277
108 Ga0496121_0870116 3300048924 Bacteria 522
109 Ga0496122_0012180 3300048925 Bacteria 8601
110 Ga0496124_0131815 3300048927 Bacteria 1985
111 Ga0496125_0084508 3300048928 Bacteria 2410
112 Ga0496126_0154323 3300048929 Bacteria 1966
113 Ga0501315_100591 3300049531 Bacteria 510
114 Ga0501316_034165 3300049532 Bacteria 691
115 Ga0501198_021481 3300049649 Bacteria 1029
116 Ga0501233_171190 3300049668 Bacteria 617
117 2524191007 2524023129 Bacteria 6762600
118 2553393077 2551306519 Bacteria 5465154
119 2595318173 2593339198 Bacteria 7267884
120 2644702870 2643221729 Bacteria 6621700
121 2644711589 2643221730 Bacteria 6523787
122 2685150483 2684622632 Bacteria 5380049
123 2698322784 2695420987 Bacteria 6152737
124 2705994390 2703719227 Bacteria 5631989
125 2721505757 2718218445 Bacteria 5113413
126 2738813838 2738541295 Bacteria 5730091
127 2739156118 2738541358 Bacteria 5932299
128 2739208896 2738543006 Bacteria 5904091
129 2739233539 2738543010 Bacteria 5583595
130 2791215710 2788500588 Bacteria 4584915
131 2819584038 2818991443 Bacteria 6598732
132 2819673015 2818991459 Bacteria 8736032
133 2857458654 2857453340 Bacteria 8090534
134 2857474514 2857472729 Bacteria 6568124
135 2857609707 2857609550 Bacteria 3753890
136 2864998271 2864997549 Bacteria 5139696
137 2865005157 2865002811 Bacteria 6333767
138 2881646557 2881644220 Bacteria 5302661
139 2885532711 2885526491 Bacteria 7164189
140 2889298806 2889295896 Bacteria 4704906
141 2904116096 2904113452 Bacteria 7796941
142 2904167524 2904162308 Bacteria 7086713
143 2904529501 2904524088 Bacteria 5887454
144 2904755785 2904755435 Bacteria 7986759
145 2919148906 2919143609 Bacteria 6219228
146 2919416654 2919414237 Bacteria 5429133
147 2919430298 2919425241 Bacteria 8055701
148 2919522645 2919517244 Bacteria 5858162
149 2925332661 2925326138 Bacteria 9652120
150 2928099941 2928093941 Bacteria 5965005
151 2929236150 2929233124 Bacteria 5948380
152 2938920125 2938917290 Bacteria 5914775
153 2939597899 2939593269 Bacteria 4798695
154 2947429228 2947426588 Bacteria 5357194
155 2965763764 2965761152 Bacteria 5806513
156 2971414781 2971410472 Bacteria 8311090
157 2979086160 2979083700 Bacteria 5894929
158 2981288154 2981284811 Bacteria 4641497
159 2981292976 2981289755 Bacteria 4641509
160 2981983880 2981980479 Bacteria 4641628
161 2981988802 2981985349 Bacteria 4641497
162 3001270673 3001267043 Bacteria 4823521
163 3001276284 3001272096 Bacteria 4729684
164 3001894893 3001892409 Bacteria 6328293
165 3006829725 3006826541 Bacteria 4678913
166 3006973269 3006969106 Bacteria 4739423
167 3006979542 3006978542 Bacteria 5328100
168 8002321653 8002317523 Bacteria 8051857
169 8022625321 8022621104 Bacteria 5241040
170 8022795724 8022792930 Bacteria 5693794
171 8023438603 8023438354 Bacteria 5779374
172 8023446124 8023444577 Bacteria 5661597
173 8046996253 8046991243 Bacteria 8497463
174 8055536902 8055531788 Bacteria 5249694
175 8056539352 8056533031 Bacteria 8964429
176 8057474227 8057473075 Bacteria 5892720
177 8057585127 8057582654 Bacteria 5218944
178 JGI25151J46595_10013899
179 JGI25159J45721_1000208
180 JGI25151J46595_10005321
181 JGI25151J46595_10011662
182 JGI25151J46595_10012042
183 JGI25151J46595_10014221
184 JGI25151J46595_10016682
185 JGI25151J46595_10023659
186 JGI25151J46595_10026995
187 JGI25151J46595_10030500
188 JGI25151J46595_10032172
189 JGI25151J46595_10032864
190 JGI25151J46595_10086809
191 Ga0055538_1000104
192 Ga0055538_1000142
193 Ga0055532_1000562
194 Ga0055536_1011783
195 Ga0105251_10008407
196 Ga0105251_10033143
197 Ga0105251_10168928
198 Ga0105244_10008973
199 Ga0105244_10013933
200 Ga0105244_10020275
201 Ga0105250_10003134
202 Ga0105250_10005181
203 Ga0105250_10019998
204 Ga0105250_10020675
205 Ga0105250_10120010
206 Ga0105250_10434744
207 Ga0105246_11102294
208 Ga0157374_10151906
209 Ga0157374_10175408
210 Ga0157376_12173218
211 Ga0209784_100038
212 Ga0209784_100129
213 Ga0209784_102263
214 Ga0209566_103636
215 Ga0209147_100115
216 Ga0209673_1039540
217 Ga0209673_1046303
218 Ga0209130_1000388
219 Ga0209130_1005375
220 Ga0209130_1023560
221 Ga0209130_1075482
222 Ga0209675_1013588
223 Ga0209675_1029618
224 Ga0209676_1000983
225 Ga0209676_1006638
226 Ga0209676_1011413
227 Ga0209025_1000605
228 Ga0209025_1001708
229 Ga0209025_1001873
230 Ga0209025_1001969
231 Ga0209025_1002578
232 Ga0209025_1004141
233 Ga0209025_1004143
234 Ga0209025_1004583
235 Ga0209025_1006042
236 Ga0209025_1007993
237 Ga0209025_1019033
238 Ga0209025_1026122
239 Ga0209025_1029869
240 Ga0209025_1045060
241 Ga0207696_1003064
242 Ga0207696_1004131
243 Ga0207696_1018700
244 Ga0207696_1042812
245 Ga0207655_1002587
246 Ga0207655_1025144
247 Ga0207655_1083285
248 Ga0207713_1004192
249 Ga0207713_1015116
250 Ga0237817_10070
251 Ga0237817_10362
252 Ga0307405_10054896
253 Ga0307410_10283425
254 Ga0307406_10348133
255 Ga0307412_10565765
256 Ga0307409_100173904
257 Ga0307416_100011589
258 Ga0373935_0935805
259 Ga0373927_0660911
260 Ga0237819_00167
261 Ga0237819_01321
262 Ga0466967_0000646
263 Ga0496100_0002572
264 Ga0496100_0311584
265 Ga0496101_0005478
266 Ga0496101_0248135
267 Ga0496102_0063547
268 Ga0496102_0063703
269 Ga0496103_0052994
270 Ga0496103_0069177
271 Ga0496104_0010120
272 Ga0496105_0006112
273 Ga0496106_0080851
274 Ga0496107_0003058
275 Ga0496107_0080274
276 Ga0496108_0197921
277 Ga0496109_0042821
278 Ga0496110_0000919
279 Ga0496110_0017190
280 Ga0496110_1594738
281 Ga0496111_0001161
282 Ga0496111_0011673
283 Ga0496112_0008675
284 Ga0496113_0097224
285 Ga0496121_0870116
286 Ga0496122_0012180
287 Ga0496124_0131815
288 Ga0496125_0084508
289 Ga0496126_0154323
290 Ga0501315_100591
291 Ga0501316_034165
292 Ga0501198_021481
293 Ga0501233_171190
294 2524191007
295 2553393077
296 2595318173
297 2644702870
298 2644711589
299 2685150483
300 2698322784
301 2705994390
302 2721505757
303 2738813838
304 2739156118
305 2739208896
306 2739233539
307 2791215710
308 2819584038
309 2819673015
310 2857458654
311 2857474514
312 2857609707
313 2864998271
314 2865005157
315 2881646557
316 2885532711
317 2889298806
318 2904116096
319 2904167524
320 2904529501
321 2904755785
322 2919148906
323 2919416654
324 2919430298
325 2919522645
326 2925332661
327 2928099941
328 2929236150
329 2938920125
330 2939597899
331 2947429228
332 2965763764
333 2971414781
334 2979086160
335 2981288154
336 2981292976
337 2981983880
338 2981988802
339 3001270673
340 3001276284
341 3001894893
342 3006829725
343 3006973269
344 3006979542
345 8002321653
346 8022625321
347 8022795724
348 8023438603
349 8023446124
350 8046996253
351 8055536902
352 8056539352
353 8057474227
354 8057585127

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

29

142

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nn5-assembly1.cif.gz_A structure of conserved protein of unknown function ef2215 from enterococcus faecalis 0.8712 3 157
1xn5-assembly1.cif.gz_A solution structure of bacillus halodurans protein bh1534: the northeast structural genomics consortium target bhr29 0.8538 13 131
2nn5-assembly1.cif.gz_A structure of conserved protein of unknown function ef2215 from enterococcus faecalis 0.8455 3 157
2m89-assembly1.cif.gz_B solution structure of the aha1 dimer from colwellia psychrerythraea 0.8382 13 132
8es5-assembly1.cif.gz_B aha1 domain protein from pseudomonas aeruginosa 0.8273 11 135
ID Description Score Start End Superfamily
2nn5A00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8648 3 157 3.30.530.20
2nn5A00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8392 3 157 3.30.530.20
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8382 13 132 3.30.530.20
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8313 9 132 3.30.530.20
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8302 15 139 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A4U3ASR1-F1-model_v4 deleted 0.9983 1 93
AF-A0A5P9Y2D2-F1-model_v4 deleted 0.9977 1 154
AF-A0A7D3YSX0-F1-model_v4 deleted 0.9969 1 151
AF-A0A6A2TGB1-F1-model_v4 deleted 0.9966 1 157
AF-A0A150AZ15-F1-model_v4 Activator of Hsp90 ATPase 1 family protein 0.996 1 158

Map