F269052

General Info

Members Datasets Scaffolds Average Seq Length
176 111 352 212

Family's Representative Sequence

Representative Sequence 3300049582|Ga0501048_0548090|Ga0501048_0548090_130_804
Length 224
Sequence LRSGAASDLSDKTAFIPDLPVLAACLVAAAILGLTPGPDMTLFLSKTVSQSRAAGLAAFSGATTGLVVHTILVALGLSAVLAASATAFTVLKVVGAIYLAWLAYDALRNGSALSLDRKGRTEALRSVYLKGLLVNLLNPKVIVFFVTFLPQFVTAADPDAAKKLLFLGFVFVLVNVPVCVGLILFADRIAVFLKRSPKATRIVDWLFAGVLGAFAVRLVAAESR

Samples

Sample ID Description Type Environment
1 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
4 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
5 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
6 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
7 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
8 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
9 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
12 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
13 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
14 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
15 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
16 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
17 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
22 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
23 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
24 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
25 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
26 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
31 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
32 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
35 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
36 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
37 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
38 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
39 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
40 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
41 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
42 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
43 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
44 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
45 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
46 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
47 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
48 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
49 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
50 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
51 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
52 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
53 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
54 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
55 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
56 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
57 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
58 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
59 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
60 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
61 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
62 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
63 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
64 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
78 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
79 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
80 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
81 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
82 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
83 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
84 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
85 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
86 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
87 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
88 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
91 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
92 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
93 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
94 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
95 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
96 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
97 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
98 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
99 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
100 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
101 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
102 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
103 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
104 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
105 2508501050 Microvirga lupini Lut6 Isolate Nodule
106 2773857925 Microvirga vignae BR3299 Isolate Unclassified
107 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
108 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
109 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
110 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
111 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.02
Metatranscriptomes 0
Isolates 3.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.39
Nodule 1.14
Rhizoplane 0
Rhizosphere 88.64
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501048_0548090 3300049582 Bacteria 830
2 Ga0070683_100030469 3300005329 Bacteria 4898
3 Ga0070674_100510076 3300005356 Bacteria 1003
4 Ga0070684_100045166 3300005535 Bacteria 3814
5 Ga0070665_100071255 3300005548 Bacteria 3482
6 Ga0068859_100108812 3300005617 Bacteria 2833
7 Ga0068860_100388912 3300005843 Bacteria 1378
8 Ga0068862_100075988 3300005844 Bacteria 2907
9 Ga0068862_100344985 3300005844 Bacteria 1380
10 Ga0081540_1013371 3300005983 Bacteria 5340
11 Ga0081539_10050776 3300005985 Bacteria 2344
12 Ga0075368_10002216 3300006042 Bacteria 6309
13 Ga0075363_100004836 3300006048 Bacteria 5947
14 Ga0075367_10000532 3300006178 Bacteria 14389
15 Ga0075428_100086470 3300006844 Bacteria 3420
16 Ga0075428_100295298 3300006844 Bacteria 1742
17 Ga0075431_100096508 3300006847 Bacteria 3052
18 Ga0075431_100403055 3300006847 Bacteria 1368
19 Ga0075431_100519187 3300006847 Bacteria 1181
20 Ga0075433_10231468 3300006852 Bacteria 1641
21 Ga0097620_100108807 3300006931 Bacteria 2833
22 Ga0105240_10084575 3300009093 Bacteria 3890
23 Ga0105240_10196697 3300009093 Bacteria 2366
24 Ga0111539_10227205 3300009094 Bacteria 2174
25 Ga0111539_10322448 3300009094 Bacteria 1798
26 Ga0114129_10292281 3300009147 Bacteria 2174
27 Ga0105248_10189270 3300009177 Bacteria 2319
28 Ga0105238_10299983 3300009551 Bacteria 1590
29 Ga0157380_10103358 3300014326 Bacteria 2377
30 Ga0157380_10402856 3300014326 Bacteria 1299
31 Ga0157380_10642328 3300014326 Bacteria 1057
32 Ga0209130_1034265 3300025284 Bacteria 1024
33 Ga0209025_1075949 3300025294 Bacteria 1166
34 Ga0207695_10068788 3300025913 Bacteria 3627
35 Ga0207695_10075972 3300025913 Bacteria 3416
36 Ga0207689_10520320 3300025942 Bacteria 998
37 Ga0207661_10109547 3300025944 Bacteria 2333
38 Ga0207668_10683397 3300025972 Bacteria 901
39 Ga0209813_10000752 3300027866 Bacteria 7397
40 Ga0207428_10033658 3300027907 Bacteria 4206
41 Ga0268266_10166773 3300028379 Bacteria 1996
42 Ga0268265_10104654 3300028380 Bacteria 2294
43 Ga0307515_10003734 3300028794 Bacteria 31935
44 Ga0265325_10004291 3300031241 Bacteria 9036
45 Ga0265325_10146552 3300031241 Bacteria 1119
46 Ga0265325_10291627 3300031241 Bacteria 730
47 Ga0265340_10000170 3300031247 Bacteria 32547
48 Ga0265340_10018185 3300031247 Bacteria 3628
49 Ga0265340_10127977 3300031247 Bacteria 1166
50 Ga0265339_10001442 3300031249 Bacteria 17648
51 Ga0265339_10082434 3300031249 Bacteria 1698
52 Ga0265331_10118589 3300031250 Bacteria 1211
53 Ga0265316_10043073 3300031344 Bacteria 3602
54 Ga0265313_10002312 3300031595 Bacteria 16699
55 Ga0265313_10033349 3300031595 Bacteria 2618
56 Ga0265314_10005114 3300031711 Bacteria 11942
57 Ga0265314_10026555 3300031711 Bacteria 4350
58 Ga0265342_10053382 3300031712 Bacteria 2405
59 Ga0265342_10074802 3300031712 Bacteria 1967
60 Ga0265342_10090825 3300031712 Bacteria 1751
61 Ga0265342_10266780 3300031712 Bacteria 909
62 Ga0307413_10006167 3300031824 Bacteria 5445
63 Ga0307410_10075007 3300031852 Bacteria 2357
64 Ga0307407_10050576 3300031903 Bacteria 2378
65 Ga0307412_10048668 3300031911 Bacteria 2789
66 Ga0307409_100253099 3300031995 Bacteria 1611
67 Ga0307416_100044228 3300032002 Bacteria 3494
68 Ga0307416_101782888 3300032002 Bacteria 720
69 Ga0307411_10018156 3300032005 Bacteria 4029
70 Ga0316574_0259830 3300035398 Bacteria 1109
71 Ga0316582_0151794 3300036647 Bacteria 1566
72 Ga0316584_0374492 3300036712 Bacteria 1019
73 Ga0373925_0005386 3300037068 Bacteria 9542
74 Ga0373925_0150602 3300037068 Bacteria 1827
75 Ga0395905_0030325 3300037471 Bacteria 5097
76 Ga0395901_0562836 3300038443 Bacteria 1154
77 Ga0436365_0542239 3300039437 Bacteria 5553
78 Ga0436362_0930544 3300039453 Bacteria 1194
79 Ga0451577_0757834 3300042876 Bacteria 878
80 Ga0466972_0065754 3300044658 Bacteria 1734
81 Ga0466965_0315901 3300044683 Bacteria 850
82 Ga0451576_0017719 3300045051 Bacteria 7826
83 Ga0495638_0033331 3300046460 Bacteria 3294
84 Ga0495638_0047728 3300046460 Bacteria 2684
85 Ga0496126_0124874 3300048929 Bacteria 2229
86 Ga0501031_0064871 3300049568 Bacteria 2379
87 Ga0501031_0112318 3300049568 Bacteria 1779
88 Ga0501031_0134780 3300049568 Bacteria 1613
89 Ga0501032_0163652 3300049569 Bacteria 1460
90 Ga0501032_0183389 3300049569 Bacteria 1370
91 Ga0501033_0051821 3300049570 Bacteria 3042
92 Ga0501033_0177252 3300049570 Bacteria 1529
93 Ga0501034_0088972 3300049571 Bacteria 3085
94 Ga0501034_0323584 3300049571 Bacteria 1474
95 Ga0501034_0542222 3300049571 Bacteria 1073
96 Ga0501034_0607809 3300049571 Bacteria 998
97 Ga0501034_0881755 3300049571 Bacteria 783
98 Ga0501036_0079741 3300049572 Bacteria 2768
99 Ga0501036_0083185 3300049572 Bacteria 2705
100 Ga0501036_0098800 3300049572 Bacteria 2468
101 Ga0501036_0216046 3300049572 Bacteria 1611
102 Ga0501037_0046856 3300049573 Bacteria 3169
103 Ga0501037_0064636 3300049573 Bacteria 2666
104 Ga0501037_0121693 3300049573 Bacteria 1876
105 Ga0501037_0257304 3300049573 Bacteria 1220
106 Ga0501038_0023419 3300049574 Bacteria 5520
107 Ga0501038_0035806 3300049574 Bacteria 4357
108 Ga0501038_0055351 3300049574 Bacteria 3408
109 Ga0501038_0223055 3300049574 Bacteria 1503
110 Ga0501038_0298474 3300049574 Bacteria 1265
111 Ga0501039_0072432 3300049575 Bacteria 2677
112 Ga0501041_0044857 3300049577 Bacteria 2687
113 Ga0501042_0076110 3300049578 Bacteria 2402
114 Ga0501043_0110549 3300049579 Bacteria 2158
115 Ga0501043_0174392 3300049579 Bacteria 1677
116 Ga0501046_0048934 3300049580 Bacteria 3346
117 Ga0501047_0089385 3300049581 Bacteria 2957
118 Ga0501047_0185994 3300049581 Bacteria 1943
119 Ga0501047_0385375 3300049581 Bacteria 1236
120 Ga0501047_0610076 3300049581 Bacteria 912
121 Ga0501048_0018403 3300049582 Bacteria 5139
122 Ga0501048_0146817 3300049582 Bacteria 1668
123 Ga0501067_0005942 3300049583 Bacteria 6765
124 Ga0501067_0209955 3300049583 Bacteria 1084
125 Ga0501068_0164238 3300049584 Bacteria 1400
126 Ga0501070_0046363 3300049586 Bacteria 3614
127 Ga0501070_0167407 3300049586 Bacteria 1811
128 Ga0501070_0880967 3300049586 Bacteria 699
129 Ga0501072_0152646 3300049588 Bacteria 1841
130 Ga0501073_0001478 3300049589 Bacteria 17403
131 Ga0501073_0018490 3300049589 Bacteria 5038
132 Ga0501073_0098081 3300049589 Bacteria 2035
133 Ga0501074_0051156 3300049590 Bacteria 2982
134 Ga0501074_0052342 3300049590 Bacteria 2947
135 Ga0501074_0120457 3300049590 Bacteria 1876
136 Ga0501076_0423120 3300049592 Bacteria 1096
137 Ga0501077_0033358 3300049593 Bacteria 3277
138 Ga0501077_0333510 3300049593 Bacteria 967
139 Ga0501079_0162660 3300049741 Bacteria 1741
140 Ga0501079_0393007 3300049741 Bacteria 1088
141 Ga0501080_0053233 3300049742 Bacteria 3767
142 Ga0501080_0245851 3300049742 Bacteria 1632
143 Ga0501080_0669669 3300049742 Bacteria 917
144 Ga0501083_0051279 3300049744 Bacteria 2775
145 Ga0501035_0003984 3300049822 Bacteria 14081
146 Ga0501035_0037525 3300049822 Bacteria 4388
147 Ga0501035_0816718 3300049822 Bacteria 744
148 Ga0501044_0049998 3300049823 Bacteria 4315
149 Ga0501044_0150091 3300049823 Bacteria 2313
150 Ga0501045_0132705 3300049824 Bacteria 1851
151 nmdc:mga03n38_4216_c1 3300050490 Bacteria 4728
152 nmdc:mga06z11_3408_c1 3300050494 Bacteria 6141
153 nmdc:mga04h51_815_c1 3300050495 Bacteria 7240
154 nmdc:mga07m45_206376_c1 3300050496 Bacteria 1143
155 nmdc:mga05p37_50595_c1 3300050507 Bacteria 5110
156 nmdc:mga0qj67_79899_c1 3300050509 Bacteria 2620
157 nmdc:mga06r32_163382_c1 3300050510 Bacteria 2209
158 nmdc:mga06r32_168885_c1 3300050510 Bacteria 2171
159 nmdc:mga06r32_325287_c1 3300050510 Bacteria 1523
160 nmdc:mga08y16_217468_c1 3300050511 Bacteria 1978
161 nmdc:mga08y16_5359_c1 3300050511 Bacteria 13416
162 nmdc:mga0a205_142756_c1 3300050515 Bacteria 2294
163 nmdc:mga0a205_335869_c1 3300050515 Bacteria 1380
164 Ga0500646_0031833 3300053090 Bacteria 1453
165 Ga0500559_0020474 3300053136 Bacteria 2797
166 Ga0500588_0046001 3300053146 Unclassified 1340
167 Ga0501084_0047962 3300054114 Bacteria 3577
168 Ga0501084_0077617 3300054114 Bacteria 2784
169 Ga0501082_0102279 3300060353 Bacteria 2478
170 2508734726 2508501050 Bacteria 9633614
171 2774871856 2773857925 Bacteria 6472445
172 2884298492 2884298095 Bacteria 3823049
173 2894241860 2894232714 Bacteria 8834183
174 2917554378 2917554339 Bacteria 4987857
175 2939674419 2939669807 Bacteria 5028511
176 8054568575 8054563764 Bacteria 5592885
177 Ga0501048_0548090
178 Ga0070683_100030469
179 Ga0070674_100510076
180 Ga0070684_100045166
181 Ga0070665_100071255
182 Ga0068859_100108812
183 Ga0068860_100388912
184 Ga0068862_100075988
185 Ga0068862_100344985
186 Ga0081540_1013371
187 Ga0081539_10050776
188 Ga0075368_10002216
189 Ga0075363_100004836
190 Ga0075367_10000532
191 Ga0075428_100086470
192 Ga0075428_100295298
193 Ga0075431_100096508
194 Ga0075431_100403055
195 Ga0075431_100519187
196 Ga0075433_10231468
197 Ga0097620_100108807
198 Ga0105240_10084575
199 Ga0105240_10196697
200 Ga0111539_10227205
201 Ga0111539_10322448
202 Ga0114129_10292281
203 Ga0105248_10189270
204 Ga0105238_10299983
205 Ga0157380_10103358
206 Ga0157380_10402856
207 Ga0157380_10642328
208 Ga0209130_1034265
209 Ga0209025_1075949
210 Ga0207695_10068788
211 Ga0207695_10075972
212 Ga0207689_10520320
213 Ga0207661_10109547
214 Ga0207668_10683397
215 Ga0209813_10000752
216 Ga0207428_10033658
217 Ga0268266_10166773
218 Ga0268265_10104654
219 Ga0307515_10003734
220 Ga0265325_10004291
221 Ga0265325_10146552
222 Ga0265325_10291627
223 Ga0265340_10000170
224 Ga0265340_10018185
225 Ga0265340_10127977
226 Ga0265339_10001442
227 Ga0265339_10082434
228 Ga0265331_10118589
229 Ga0265316_10043073
230 Ga0265313_10002312
231 Ga0265313_10033349
232 Ga0265314_10005114
233 Ga0265314_10026555
234 Ga0265342_10053382
235 Ga0265342_10074802
236 Ga0265342_10090825
237 Ga0265342_10266780
238 Ga0307413_10006167
239 Ga0307410_10075007
240 Ga0307407_10050576
241 Ga0307412_10048668
242 Ga0307409_100253099
243 Ga0307416_100044228
244 Ga0307416_101782888
245 Ga0307411_10018156
246 Ga0316574_0259830
247 Ga0316582_0151794
248 Ga0316584_0374492
249 Ga0373925_0005386
250 Ga0373925_0150602
251 Ga0395905_0030325
252 Ga0395901_0562836
253 Ga0436365_0542239
254 Ga0436362_0930544
255 Ga0451577_0757834
256 Ga0466972_0065754
257 Ga0466965_0315901
258 Ga0451576_0017719
259 Ga0495638_0033331
260 Ga0495638_0047728
261 Ga0496126_0124874
262 Ga0501031_0064871
263 Ga0501031_0112318
264 Ga0501031_0134780
265 Ga0501032_0163652
266 Ga0501032_0183389
267 Ga0501033_0051821
268 Ga0501033_0177252
269 Ga0501034_0088972
270 Ga0501034_0323584
271 Ga0501034_0542222
272 Ga0501034_0607809
273 Ga0501034_0881755
274 Ga0501036_0079741
275 Ga0501036_0083185
276 Ga0501036_0098800
277 Ga0501036_0216046
278 Ga0501037_0046856
279 Ga0501037_0064636
280 Ga0501037_0121693
281 Ga0501037_0257304
282 Ga0501038_0023419
283 Ga0501038_0035806
284 Ga0501038_0055351
285 Ga0501038_0223055
286 Ga0501038_0298474
287 Ga0501039_0072432
288 Ga0501041_0044857
289 Ga0501042_0076110
290 Ga0501043_0110549
291 Ga0501043_0174392
292 Ga0501046_0048934
293 Ga0501047_0089385
294 Ga0501047_0185994
295 Ga0501047_0385375
296 Ga0501047_0610076
297 Ga0501048_0018403
298 Ga0501048_0146817
299 Ga0501067_0005942
300 Ga0501067_0209955
301 Ga0501068_0164238
302 Ga0501070_0046363
303 Ga0501070_0167407
304 Ga0501070_0880967
305 Ga0501072_0152646
306 Ga0501073_0001478
307 Ga0501073_0018490
308 Ga0501073_0098081
309 Ga0501074_0051156
310 Ga0501074_0052342
311 Ga0501074_0120457
312 Ga0501076_0423120
313 Ga0501077_0033358
314 Ga0501077_0333510
315 Ga0501079_0162660
316 Ga0501079_0393007
317 Ga0501080_0053233
318 Ga0501080_0245851
319 Ga0501080_0669669
320 Ga0501083_0051279
321 Ga0501035_0003984
322 Ga0501035_0037525
323 Ga0501035_0816718
324 Ga0501044_0049998
325 Ga0501044_0150091
326 Ga0501045_0132705
327 nmdc:mga03n38_4216_c1
328 nmdc:mga06z11_3408_c1
329 nmdc:mga04h51_815_c1
330 nmdc:mga07m45_206376_c1
331 nmdc:mga05p37_50595_c1
332 nmdc:mga0qj67_79899_c1
333 nmdc:mga06r32_163382_c1
334 nmdc:mga06r32_168885_c1
335 nmdc:mga06r32_325287_c1
336 nmdc:mga08y16_217468_c1
337 nmdc:mga08y16_5359_c1
338 nmdc:mga0a205_142756_c1
339 nmdc:mga0a205_335869_c1
340 Ga0500646_0031833
341 Ga0500559_0020474
342 Ga0500588_0046001
343 Ga0501084_0047962
344 Ga0501084_0077617
345 Ga0501082_0102279
346 2508734726
347 2774871856
348 2884298492
349 2894241860
350 2917554378
351 2939674419
352 8054568575

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

30

222

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xzi-assembly1.cif.gz_A cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.463 9 204
7xzi-assembly1.cif.gz_A cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.4304 9 204
7vcf-assembly1.cif.gz_A cryo-em structure of chlamydomonas toc-tic supercomplex 0.4003 4 204
7zc2-assembly1.cif.gz_A dipeptide and tripeptide permease c (dtpc) 0.3911 6 212
5oxl-assembly1.cif.gz_A peptst in complex with dipeptide ala-leu 0.3887 5 210
ID Description Score Start End Superfamily
af_Q9P7Q0_1_262_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6268 6 210 1.20.1250.20
af_Q9P7Q0_1_262_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6046 6 210 1.20.1250.20
af_B9G125_1_232_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5342 4 210 1.20.1250.20
af_Q10320_1_287_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.527 5 210 1.20.1250.20
af_B9G125_1_232_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5208 4 210 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A0Q6EV56-F1-model_v4 Threonine transporter RhtB 0.9824 1 210 GO:0005886
GO:0015171
AF-A0A2G8MQ77-F1-model_v4 deleted 0.9725 1 209
AF-A0A0Q6EV56-F1-model_v4 Threonine transporter RhtB 0.9687 1 210 GO:0005886
GO:0015171
AF-A0A5E8AU42-F1-model_v4 Putative threonine efflux protein 0.9684 2 208 GO:0005886
GO:0015171
AF-A0A3E1BCG9-F1-model_v4 deleted 0.9649 1 209

Map