F268803

General Info

Members Datasets Scaffolds Average Seq Length
176 118 352 622

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0081465|Ga0451576_0081465_171_2216
Length 681
Sequence LVYRQNDCLSEFLNRSKNLQQQFFSSLHGTITMIEQTATELVHARRFPVGAERISGKGVHFRVWAPQRKTVKLALNPQGENIESNSAPIEVELQNEGNGYFSAICGQAAVGTLYRFLLDDDSQPYPDPASRFQPQGPHGPSQVIDALTFTWTDANWPGVKAQGQVIYEMHIGTFTREGNWLAAAKELPELAALGVTVLEIMPVADFPGRFGWGYDGVNLFAPTRLYGTPDEFRHFVNQAHEVGLGVILDVVFNHLGPDGNYLGKFSNKYFTSRYECEWGDALNFDGPDSGPVRDYVLANGAYWIKEFHLDGLRIDATQQIFDSSAENIIAAIVRTVRDAGAPRLTFIIGENEPQDAKLFRLPEYGGFGIDALWNDDFHHAAMVAMTGRADAYYSDYRGTAQEFVSTLKRGFLYQGQWYSWQNKTRGTPGLDMLPAKFINFIQNHDQLANSGSGKRVHLLTSPNRYRALTALFLLAPQTPMLFQGQEFAATSPFFYFADHKGEIAYLVARGRSQFLAQFRSLATPEMQARLPDPGDPLTFTHSKLNLDDRHLHKEEYALHRDLLKLRRNDPVFQASQQSRRIDGAVLNADAFAIRFFGENPGDDRLLLINLSRDIHLVPAPEPLLAPPEERIWDVMWASEDPCYGGMGMPPWPRQGNWYIQGESAVVLTPVKPPKEAVNHEQ

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
46 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
59 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
62 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
63 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
64 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
67 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
68 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
73 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
74 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
75 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
76 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
77 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
78 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
79 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
80 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
81 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
82 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
83 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
84 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
85 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
99 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
100 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
101 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
102 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
103 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
106 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
107 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
108 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
109 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
110 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
111 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
112 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
113 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
114 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
115 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
116 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
117 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
118 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.41
Nodule 0
Rhizoplane 5.11
Rhizosphere 81.82
Stem 0
Stem Tuber 0
Unclassified 1.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0081465 3300045051 Bacteria 3366
2 Ga0070658_10008349 3300005327 Bacteria 8329
3 Ga0070658_10039712 3300005327 Bacteria 3797
4 Ga0068869_100053288 3300005334 Bacteria 2940
5 Ga0070680_100038298 3300005336 Bacteria 3878
6 Ga0070689_100016597 3300005340 Bacteria 5390
7 Ga0070669_100013983 3300005353 Bacteria 5707
8 Ga0070714_100011659 3300005435 Bacteria 6979
9 Ga0070713_100000657 3300005436 Bacteria 22119
10 Ga0070705_100004025 3300005440 Bacteria 7182
11 Ga0070708_100000755 3300005445 Bacteria 24367
12 Ga0070681_10051448 3300005458 Bacteria 4109
13 Ga0068867_100004784 3300005459 Bacteria 9530
14 Ga0068867_100033164 3300005459 Bacteria 3738
15 Ga0070706_100000379 3300005467 Bacteria 53225
16 Ga0070707_100001214 3300005468 Bacteria 25371
17 Ga0070699_100004422 3300005518 Bacteria 12425
18 Ga0070679_100040747 3300005530 Bacteria 4621
19 Ga0070679_100050105 3300005530 Bacteria 4160
20 Ga0068853_100013380 3300005539 Bacteria 6697
21 Ga0068853_100013631 3300005539 Bacteria 6642
22 Ga0070665_100144133 3300005548 Bacteria 2385
23 Ga0070704_100042307 3300005549 Bacteria 3150
24 Ga0068855_100073034 3300005563 Bacteria 3986
25 Ga0068855_100194458 3300005563 Bacteria 2286
26 Ga0068856_100005081 3300005614 Bacteria 13012
27 Ga0068856_100006050 3300005614 Bacteria 11891
28 Ga0068856_100023177 3300005614 Bacteria 6038
29 Ga0068852_100068583 3300005616 Bacteria 3105
30 Ga0068859_100097305 3300005617 Bacteria 2996
31 Ga0081538_10006167 3300005981 Bacteria 10631
32 Ga0081539_10000790 3300005985 Bacteria 61618
33 Ga0070717_10000902 3300006028 Bacteria 19721
34 Ga0070717_10086533 3300006028 Bacteria 2638
35 Ga0075367_10020100 3300006178 Bacteria 3714
36 Ga0075366_10000927 3300006195 Bacteria 14230
37 Ga0075428_100013949 3300006844 Bacteria 8945
38 Ga0075433_10083191 3300006852 Bacteria 2824
39 Ga0075434_100009862 3300006871 Bacteria 8933
40 Ga0075434_100047481 3300006871 Bacteria 4261
41 Ga0075429_100013186 3300006880 Bacteria 7171
42 Ga0075436_100047114 3300006914 Bacteria 2973
43 Ga0097620_100097305 3300006931 Bacteria 2996
44 Ga0075435_100064211 3300007076 Bacteria 2982
45 Ga0075435_100064809 3300007076 Bacteria 2970
46 Ga0111539_10001291 3300009094 Bacteria 33417
47 Ga0111539_10002367 3300009094 Bacteria 25059
48 Ga0111539_10008669 3300009094 Bacteria 12908
49 Ga0114129_10103885 3300009147 Bacteria 3928
50 Ga0114129_10154289 3300009147 Bacteria 3141
51 Ga0105241_10036364 3300009174 Bacteria 3705
52 Ga0105237_10055476 3300009545 Bacteria 3968
53 Ga0105238_10001013 3300009551 Bacteria 28671
54 Ga0105238_10030651 3300009551 Bacteria 5475
55 Ga0157373_10033004 3300013100 Bacteria 3726
56 Ga0157369_10001365 3300013105 Bacteria 30097
57 Ga0157369_10002856 3300013105 Bacteria 20635
58 Ga0157369_10096816 3300013105 Bacteria 3148
59 Ga0157374_10007501 3300013296 Bacteria 9302
60 Ga0157372_10001111 3300013307 Bacteria 29223
61 Ga0213875_10000006 3300021388 Bacteria 579005
62 Ga0213875_10000027 3300021388 Bacteria 190420
63 Ga0213875_10000500 3300021388 Bacteria 32837
64 Ga0213875_10004642 3300021388 Bacteria 7487
65 Ga0213875_10014974 3300021388 Bacteria 3777
66 Ga0213871_10000818 3300021441 Bacteria 4656
67 Ga0207705_10034921 3300025909 Bacteria 3597
68 Ga0207684_10008711 3300025910 Bacteria 9005
69 Ga0207684_10029004 3300025910 Bacteria 4713
70 Ga0207695_10000426 3300025913 Bacteria 93260
71 Ga0207662_10001699 3300025918 Bacteria 10787
72 Ga0207652_10032550 3300025921 Bacteria 4385
73 Ga0207694_10039077 3300025924 Bacteria 3650
74 Ga0207700_10001140 3300025928 Bacteria 15244
75 Ga0207667_10007138 3300025949 Bacteria 13485
76 Ga0207667_10082698 3300025949 Bacteria 3325
77 Ga0207639_10014798 3300026041 Bacteria 5494
78 Ga0207639_10056927 3300026041 Bacteria 2999
79 Ga0207708_10008420 3300026075 Bacteria 7631
80 Ga0207683_10077163 3300026121 Bacteria 2950
81 Ga0207428_10000343 3300027907 Bacteria 60532
82 Ga0207428_10003910 3300027907 Bacteria 14292
83 Ga0207428_10017799 3300027907 Bacteria 6093
84 Ga0265334_10003907 3300028573 Bacteria 6713
85 Ga0265338_10003726 3300028800 Bacteria 21200
86 Ga0265328_10000599 3300031239 Bacteria 16745
87 Ga0265320_10016099 3300031240 Bacteria 4200
88 Ga0265320_10016132 3300031240 Bacteria 4197
89 Ga0265339_10006652 3300031249 Bacteria 7562
90 Ga0265339_10012523 3300031249 Bacteria 5176
91 Ga0265339_10022980 3300031249 Bacteria 3607
92 Ga0265327_10027970 3300031251 Bacteria 3236
93 Ga0307408_100044424 3300031548 Bacteria 3166
94 Ga0265314_10002934 3300031711 Bacteria 16909
95 Ga0265314_10021859 3300031711 Bacteria 4908
96 Ga0265342_10000441 3300031712 Bacteria 45373
97 Ga0265342_10002527 3300031712 Bacteria 15752
98 Ga0373935_0042048 3300035692 Bacteria 2873
99 Ga0373937_0003829 3300036401 Bacteria 12711
100 Ga0436364_0164047 3300037853 Bacteria 7462
101 Ga0436364_0203024 3300037853 Unclassified 2535
102 Ga0436364_0446012 3300037853 Bacteria 193523
103 Ga0436364_0478514 3300037853 Bacteria 578677
104 Ga0436364_0723871 3300037853 Bacteria 3707
105 Ga0436364_0810524 3300037853 Bacteria 3470
106 Ga0436364_0951725 3300037853 Bacteria 44862
107 Ga0436364_0977964 3300037853 Bacteria 16438
108 Ga0436364_1310683 3300037853 Bacteria 7974
109 Ga0436365_0310583 3300039437 Bacteria 15165
110 Ga0436365_1170933 3300039437 Bacteria 3576
111 Ga0436360_0294459 3300039438 Unclassified 2461
112 Ga0436360_0767964 3300039438 Bacteria 2108
113 Ga0436360_1352123 3300039438 Bacteria 10259
114 Ga0436362_0165050 3300039453 Bacteria 7517
115 Ga0453684_0202567 3300044712 Unclassified 2313
116 Ga0453684_0274763 3300044712 Bacteria 1924
117 Ga0451576_0000560 3300045051 Bacteria 79638
118 Ga0451576_0001012 3300045051 Bacteria 51921
119 Ga0451576_0041135 3300045051 Bacteria 4887
120 Ga0466958_0047781 3300045836 Bacteria 2584
121 Ga0495659_0036773 3300046664 Bacteria 1731
122 Ga0496101_0073830 3300048904 Bacteria 2506
123 Ga0496104_0108383 3300048907 Bacteria 2662
124 Ga0496105_0011422 3300048908 Bacteria 7016
125 Ga0496106_0009838 3300048909 Bacteria 7063
126 Ga0496108_0001552 3300048911 Bacteria 18176
127 Ga0496110_0002654 3300048913 Bacteria 13491
128 Ga0496112_0011578 3300048915 Bacteria 8064
129 Ga0496112_0043174 3300048915 Bacteria 4414
130 Ga0496115_0080391 3300048918 Bacteria 2654
131 Ga0501032_0046189 3300049569 Bacteria 2943
132 Ga0501033_0010831 3300049570 Bacteria 6993
133 Ga0501033_0056223 3300049570 Bacteria 2909
134 Ga0501034_0006693 3300049571 Bacteria 12359
135 Ga0501034_0020643 3300049571 Bacteria 6728
136 Ga0501034_0081258 3300049571 Bacteria 3243
137 Ga0501036_0019053 3300049572 Bacteria 5758
138 Ga0501037_0009921 3300049573 Bacteria 6985
139 Ga0501038_0016016 3300049574 Bacteria 6811
140 Ga0501039_0024571 3300049575 Bacteria 4629
141 Ga0501039_0100356 3300049575 Bacteria 2259
142 Ga0501041_0029611 3300049577 Bacteria 3303
143 Ga0501042_0083775 3300049578 Bacteria 2286
144 Ga0501043_0004846 3300049579 Bacteria 10880
145 Ga0501046_0050675 3300049580 Bacteria 3279
146 Ga0501047_0000839 3300049581 Bacteria 31719
147 Ga0501047_0033960 3300049581 Bacteria 4924
148 Ga0501048_0073390 3300049582 Bacteria 2415
149 Ga0501067_0056765 3300049583 Bacteria 2168
150 Ga0501068_0011597 3300049584 Bacteria 4978
151 Ga0501073_0002920 3300049589 Bacteria 12829
152 Ga0501074_0019115 3300049590 Bacteria 4974
153 Ga0501075_0000426 3300049591 Bacteria 24768
154 Ga0501035_0001930 3300049822 Bacteria 20771
155 Ga0501035_0025145 3300049822 Bacteria 5458
156 Ga0501044_0002855 3300049823 Bacteria 19659
157 Ga0501044_0015611 3300049823 Bacteria 8180
158 Ga0501044_0056223 3300049823 Bacteria 4039
159 nmdc:mga03683_18781_c1 3300050489 Bacteria 2633
160 nmdc:mga0k408_1525_c1 3300050493 Bacteria 12510
161 nmdc:mga06z11_279_c1 3300050494 Bacteria 19962
162 nmdc:mga04h51_6770_c1 3300050495 Bacteria 2992
163 nmdc:mga05p37_16195_c1 3300050507 Bacteria 8976
164 nmdc:mga08y16_2797_c1 3300050511 Bacteria 17890
165 nmdc:mga08y16_67757_c1 3300050511 Bacteria 3723
166 nmdc:mga0n895_14591_c1 3300050512 Bacteria 7142
167 nmdc:mga0n895_15116_c1 3300050512 Bacteria 7034
168 nmdc:mga0rr50_31069_c1 3300050513 Bacteria 3788
169 nmdc:mga08x19_3913_c1 3300050514 Bacteria 8861
170 Ga0501084_0004839 3300054114 Bacteria 11006
171 Ga0501084_0021666 3300054114 Bacteria 5358
172 Ga0590075_000074 3300059424 Bacteria 25445
173 Ga0590077_000056 3300059426 Bacteria 27300
174 Ga0501082_0000444 3300060353 Bacteria 36630
175 Ga0501082_0019632 3300060353 Bacteria 5827
176 8001524096 8001522603 Bacteria 4726425
177 Ga0451576_0081465
178 Ga0070658_10008349
179 Ga0070658_10039712
180 Ga0068869_100053288
181 Ga0070680_100038298
182 Ga0070689_100016597
183 Ga0070669_100013983
184 Ga0070714_100011659
185 Ga0070713_100000657
186 Ga0070705_100004025
187 Ga0070708_100000755
188 Ga0070681_10051448
189 Ga0068867_100004784
190 Ga0068867_100033164
191 Ga0070706_100000379
192 Ga0070707_100001214
193 Ga0070699_100004422
194 Ga0070679_100040747
195 Ga0070679_100050105
196 Ga0068853_100013380
197 Ga0068853_100013631
198 Ga0070665_100144133
199 Ga0070704_100042307
200 Ga0068855_100073034
201 Ga0068855_100194458
202 Ga0068856_100005081
203 Ga0068856_100006050
204 Ga0068856_100023177
205 Ga0068852_100068583
206 Ga0068859_100097305
207 Ga0081538_10006167
208 Ga0081539_10000790
209 Ga0070717_10000902
210 Ga0070717_10086533
211 Ga0075367_10020100
212 Ga0075366_10000927
213 Ga0075428_100013949
214 Ga0075433_10083191
215 Ga0075434_100009862
216 Ga0075434_100047481
217 Ga0075429_100013186
218 Ga0075436_100047114
219 Ga0097620_100097305
220 Ga0075435_100064211
221 Ga0075435_100064809
222 Ga0111539_10001291
223 Ga0111539_10002367
224 Ga0111539_10008669
225 Ga0114129_10103885
226 Ga0114129_10154289
227 Ga0105241_10036364
228 Ga0105237_10055476
229 Ga0105238_10001013
230 Ga0105238_10030651
231 Ga0157373_10033004
232 Ga0157369_10001365
233 Ga0157369_10002856
234 Ga0157369_10096816
235 Ga0157374_10007501
236 Ga0157372_10001111
237 Ga0213875_10000006
238 Ga0213875_10000027
239 Ga0213875_10000500
240 Ga0213875_10004642
241 Ga0213875_10014974
242 Ga0213871_10000818
243 Ga0207705_10034921
244 Ga0207684_10008711
245 Ga0207684_10029004
246 Ga0207695_10000426
247 Ga0207662_10001699
248 Ga0207652_10032550
249 Ga0207694_10039077
250 Ga0207700_10001140
251 Ga0207667_10007138
252 Ga0207667_10082698
253 Ga0207639_10014798
254 Ga0207639_10056927
255 Ga0207708_10008420
256 Ga0207683_10077163
257 Ga0207428_10000343
258 Ga0207428_10003910
259 Ga0207428_10017799
260 Ga0265334_10003907
261 Ga0265338_10003726
262 Ga0265328_10000599
263 Ga0265320_10016099
264 Ga0265320_10016132
265 Ga0265339_10006652
266 Ga0265339_10012523
267 Ga0265339_10022980
268 Ga0265327_10027970
269 Ga0307408_100044424
270 Ga0265314_10002934
271 Ga0265314_10021859
272 Ga0265342_10000441
273 Ga0265342_10002527
274 Ga0373935_0042048
275 Ga0373937_0003829
276 Ga0436364_0164047
277 Ga0436364_0203024
278 Ga0436364_0446012
279 Ga0436364_0478514
280 Ga0436364_0723871
281 Ga0436364_0810524
282 Ga0436364_0951725
283 Ga0436364_0977964
284 Ga0436364_1310683
285 Ga0436365_0310583
286 Ga0436365_1170933
287 Ga0436360_0294459
288 Ga0436360_0767964
289 Ga0436360_1352123
290 Ga0436362_0165050
291 Ga0453684_0202567
292 Ga0453684_0274763
293 Ga0451576_0000560
294 Ga0451576_0001012
295 Ga0451576_0041135
296 Ga0466958_0047781
297 Ga0495659_0036773
298 Ga0496101_0073830
299 Ga0496104_0108383
300 Ga0496105_0011422
301 Ga0496106_0009838
302 Ga0496108_0001552
303 Ga0496110_0002654
304 Ga0496112_0011578
305 Ga0496112_0043174
306 Ga0496115_0080391
307 Ga0501032_0046189
308 Ga0501033_0010831
309 Ga0501033_0056223
310 Ga0501034_0006693
311 Ga0501034_0020643
312 Ga0501034_0081258
313 Ga0501036_0019053
314 Ga0501037_0009921
315 Ga0501038_0016016
316 Ga0501039_0024571
317 Ga0501039_0100356
318 Ga0501041_0029611
319 Ga0501042_0083775
320 Ga0501043_0004846
321 Ga0501046_0050675
322 Ga0501047_0000839
323 Ga0501047_0033960
324 Ga0501048_0073390
325 Ga0501067_0056765
326 Ga0501068_0011597
327 Ga0501073_0002920
328 Ga0501074_0019115
329 Ga0501075_0000426
330 Ga0501035_0001930
331 Ga0501035_0025145
332 Ga0501044_0002855
333 Ga0501044_0015611
334 Ga0501044_0056223
335 nmdc:mga03683_18781_c1
336 nmdc:mga0k408_1525_c1
337 nmdc:mga06z11_279_c1
338 nmdc:mga04h51_6770_c1
339 nmdc:mga05p37_16195_c1
340 nmdc:mga08y16_2797_c1
341 nmdc:mga08y16_67757_c1
342 nmdc:mga0n895_14591_c1
343 nmdc:mga0n895_15116_c1
344 nmdc:mga0rr50_31069_c1
345 nmdc:mga08x19_3913_c1
346 Ga0501084_0004839
347 Ga0501084_0021666
348 Ga0590075_000074
349 Ga0590077_000056
350 Ga0501082_0000444
351 Ga0501082_0019632
352 8001524096

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00128

Alpha-amylase

Alpha amylase, catalytic domain

178

289

0.85

PF11941

DUF3459

Domain of unknown function (DUF3459)

558

667

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vge-assembly1.cif.gz_A crystal structure of glycosyltrehalose trehalohydrolase (d252s) 0.9472 22 635
3vgd-assembly1.cif.gz_A ctystal structure of glycosyltrehalose trehalohydrolase (d252e) 0.947 22 635
3vge-assembly1.cif.gz_A crystal structure of glycosyltrehalose trehalohydrolase (d252s) 0.9424 22 635
1eha-assembly1.cif.gz_A crystal structure of glycosyltrehalose trehalohydrolase from sulfolobus solfataricus 0.9422 22 636
3vgd-assembly1.cif.gz_A ctystal structure of glycosyltrehalose trehalohydrolase (d252e) 0.9421 22 635
ID Description Score Start End Superfamily
3vghA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9565 129 538 3.20.20.80
2by0A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9478 124 543 3.20.20.80
2by0A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9377 124 543 3.20.20.80
3vghA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9357 129 538 3.20.20.80
3m07A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9299 125 544 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A060BVC6-F1-model_v4 Alpha-amylase 0.9845 97 266 GO:0005737
GO:0005975
GO:0016787
AF-A0A2W5ZVR5-F1-model_v4 Malto-oligosyltrehalose trehalohydrolase 0.9841 11 341 GO:0005737
GO:0005975
GO:0016787
AF-A0A2V5VUU9-F1-model_v4 Malto-oligosyltrehalose trehalohydrolase 0.9838 371 641 GO:0016798
AF-A0A4Q6F2Z9-F1-model_v4 deleted 0.9832 18 372
AF-A0A0U5JFT0-F1-model_v4 Malto-oligosyltrehalose trehalohydrolase (MTHase) (EC 3.2.1.141) (4-alpha-D-((1->4)-alpha-D-glucano)trehalose trehalohydrolase) (Maltooligosyl trehalose trehalohydrolase) 0.982 15 642 GO:0005737
GO:0005992
GO:0033942

Map