F268740

General Info

Members Datasets Scaffolds Average Seq Length
176 144 352 278

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_0097713|Ga0451853_0097713_191_1123
Length 310
Sequence VVLGILGVTAVRVAPASSLFATCFTVLQGEFMPSARPRLLYVTDLSYPARGRRYCDEDIFLTARLREDFDLALCHPLDAAALMHAFDAVVVRNSGPVLEYQAAYDDFRERAAATGTRVYNPLTGKADMAGKQYLVDLSAAGHPVIPTVDRPEDLHRLPKADAYVVKPKLGADSIGLEIVAEDRLRDLTDGSVLVQPRIDFTYEVSFCFVDHEFQYALYAPHTDRRWQLEPYRPTPADLRFAQHFIDWNGLGHGIQRVDACRAPDGELLLVELEDLNPYLSLDALGEETRHLFVAALKASLSRFLDAAPRT

Samples

Sample ID Description Type Environment
1 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
7 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
8 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
9 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
10 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
11 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
12 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
13 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
14 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
15 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
16 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
17 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
18 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
19 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
20 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
21 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
22 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
23 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
24 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
25 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
26 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
27 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
28 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
29 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
30 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
31 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
32 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
33 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
34 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
35 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
36 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
37 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
38 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
39 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
40 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
41 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
42 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
43 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
44 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
45 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
46 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
47 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
48 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
49 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
50 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
51 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
52 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
53 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
54 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
55 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
56 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
57 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
58 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
59 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
60 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
61 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
62 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
63 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
64 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
65 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
66 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
67 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
68 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
69 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
70 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
71 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
72 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
73 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
74 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
75 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
76 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
77 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
78 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
79 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
80 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
81 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
82 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
83 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
84 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
85 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
86 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
87 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
88 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
89 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
90 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
91 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
92 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
93 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
98 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
99 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
100 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
101 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
102 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
103 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
104 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
105 2643221548 Streptomyces sp. Root55 Isolate Unclassified
106 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
107 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
108 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
109 2643221647 Streptomyces sp. Root369 Isolate Unclassified
110 2643221670 Streptomyces sp. Root431 Isolate Unclassified
111 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
112 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
113 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
114 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
115 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
116 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
117 2808606448 Streptomyces sp. 193411 Isolate Unclassified
118 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
119 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
120 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
121 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
122 2862574272 Streptomyces sp. AcE210 Isolate Nodule
123 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
124 2867428634 Streptomyces sp. RP5T Isolate Unclassified
125 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
126 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
127 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
128 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
129 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
130 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
131 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
132 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
133 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
134 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
135 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
136 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
137 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
138 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
139 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
140 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
141 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
142 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
143 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
144 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 73.86
Metatranscriptomes 0.57
Isolates 25.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.27
Nodule 0.57
Rhizoplane 0.57
Rhizosphere 70.45
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451853_0097713 3300041512 Bacteria 1581
2 rootH1_10068344 3300003316 Bacteria 3788
3 rootH2_10107651 3300003320 Bacteria 2379
4 rootH1_10011819 3300003323 Bacteria 2191
5 Ga0006562J51391_1159950 3300003578 Bacteria 1160
6 Ga0105244_10185738 3300009036 Bacteria 984
7 Ga0105246_10002495 3300011119 Bacteria 11126
8 Ga0157372_10722018 3300013307 Bacteria 1159
9 Ga0183367_1004 3300015688 Bacteria 716880
10 Ga0209758_1003720 3300025297 Bacteria 13523
11 Ga0307515_10007816 3300028794 Bacteria 21032
12 Ga0307511_10000186 3300030521 Bacteria 61499
13 Ga0307512_10038832 3300030522 Bacteria 3998
14 Ga0307513_10171686 3300031456 Bacteria 2045
15 Ga0307509_10059664 3300031507 Bacteria 4036
16 Ga0307509_10109038 3300031507 Bacteria 2780
17 Ga0307514_10061381 3300031649 Bacteria 2864
18 Ga0307514_10248420 3300031649 Bacteria 1056
19 Ga0307516_10012656 3300031730 Bacteria 9072
20 Ga0307518_10008633 3300031838 Bacteria 7284
21 Ga0307518_10049995 3300031838 Bacteria 3039
22 Ga0307518_10225189 3300031838 Bacteria 1220
23 Ga0307507_10049480 3300033179 Bacteria 4071
24 Ga0307510_10137831 3300033180 Bacteria 2092
25 Ga0451807_0815885 3300041486 Unclassified 1293
26 Ga0451837_1752382 3300041494 Bacteria 2990
27 Ga0451845_0702907 3300041501 Bacteria 1383
28 Ga0451853_0003332 3300041512 Bacteria 2401
29 Ga0451853_1236331 3300041512 Bacteria 1434
30 Ga0451853_2125091 3300041512 Bacteria 1061
31 Ga0439448_0002260 3300042005 Bacteria 5207
32 Ga0450894_000179 3300042131 Bacteria 11321
33 Ga0450903_000789 3300042138 Bacteria 6167
34 Ga0450903_014461 3300042138 Bacteria 1248
35 Ga0439458_0003071 3300042157 Bacteria 3978
36 Ga0450908_004497 3300042184 Bacteria 2684
37 Ga0466972_0007230 3300044658 Bacteria 5576
38 Ga0466972_0007427 3300044658 Bacteria 5510
39 Ga0466966_0053305 3300044684 Bacteria 2566
40 Ga0466966_0140211 3300044684 Bacteria 1478
41 Ga0466961_0004976 3300044693 Bacteria 8357
42 Ga0466960_0248338 3300044901 Bacteria 987
43 Ga0495592_0035590 3300046454 Bacteria 3752
44 Ga0495603_0015011 3300046455 Bacteria 4682
45 Ga0495638_0028918 3300046460 Bacteria 3576
46 Ga0495582_0162139 3300046473 Bacteria 1272
47 Ga0495605_0002404 3300046474 Bacteria 11580
48 Ga0495662_0025263 3300046476 Bacteria 2868
49 Ga0495664_0000517 3300046477 Bacteria 19337
50 Ga0495585_0014133 3300046492 Bacteria 4659
51 Ga0495594_0071047 3300046499 Bacteria 1935
52 Ga0495596_0117197 3300046500 Bacteria 1034
53 Ga0495606_0000332 3300046507 Bacteria 81774
54 Ga0495606_0116302 3300046507 Bacteria 1606
55 Ga0495608_0032219 3300046511 Bacteria 3543
56 Ga0495616_0050844 3300046513 Bacteria 2070
57 Ga0495618_0012361 3300046514 Bacteria 5183
58 Ga0495620_0013025 3300046515 Bacteria 4269
59 Ga0495620_0112729 3300046515 Bacteria 1076
60 Ga0495628_0076154 3300046516 Bacteria 2611
61 Ga0495631_0006400 3300046518 Bacteria 6076
62 Ga0495632_0133634 3300046519 Bacteria 1154
63 Ga0495666_0030365 3300046526 Bacteria 2652
64 Ga0495652_0009749 3300046529 Bacteria 8713
65 Ga0495654_0071993 3300046530 Bacteria 1637
66 Ga0495640_0017254 3300046533 Bacteria 5383
67 Ga0495587_0000603 3300046536 Bacteria 24572
68 Ga0495645_0024479 3300046543 Bacteria 4381
69 Ga0495622_0013626 3300046557 Bacteria 3769
70 Ga0495633_0115902 3300046558 Bacteria 1241
71 Ga0495667_0040552 3300046559 Bacteria 3091
72 Ga0495668_0002578 3300046616 Bacteria 14705
73 Ga0495634_0023854 3300046642 Bacteria 4297
74 Ga0495634_0063825 3300046642 Bacteria 2443
75 Ga0495611_0021261 3300046648 Bacteria 2801
76 Ga0495625_0004292 3300046660 Bacteria 13557
77 Ga0495625_0004735 3300046660 Bacteria 12736
78 Ga0495635_0209508 3300046663 Bacteria 1320
79 Ga0495661_0020531 3300046665 Bacteria 4311
80 Ga0495588_0011355 3300046674 Bacteria 4176
81 Ga0495657_0005134 3300046675 Bacteria 10378
82 Ga0495657_0012807 3300046675 Bacteria 6217
83 Ga0495599_0149912 3300046678 Bacteria 1445
84 Ga0495623_0060532 3300046679 Bacteria 2376
85 Ga0495613_0004450 3300046689 Bacteria 10501
86 Ga0495613_0083971 3300046689 Bacteria 2312
87 Ga0495670_0043029 3300046691 Bacteria 2254
88 Ga0495671_0052273 3300046692 Bacteria 2031
89 Ga0495649_0005350 3300046694 Bacteria 8188
90 Ga0495589_0021682 3300046794 Bacteria 3282
91 Ga0495600_0004141 3300046809 Bacteria 8637
92 Ga0495581_0080412 3300047315 Bacteria 1886
93 Ga0495604_0019983 3300047317 Bacteria 5352
94 Ga0495604_0135586 3300047317 Bacteria 1764
95 Ga0495636_0104826 3300047318 Bacteria 1239
96 Ga0495636_0124882 3300047318 Bacteria 1141
97 Ga0495636_0190143 3300047318 Bacteria 934
98 Ga0495674_0192179 3300047319 Bacteria 1696
99 Ga0495676_0012101 3300047321 Bacteria 7781
100 Ga0495676_0046388 3300047321 Bacteria 3526
101 Ga0495676_0090397 3300047321 Bacteria 2291
102 Ga0495680_0018130 3300047322 Bacteria 5986
103 Ga0495683_0032108 3300047323 Bacteria 2675
104 Ga0495683_0069144 3300047323 Bacteria 1735
105 Ga0495687_001612 3300047443 Bacteria 20334
106 Ga0495687_003019 3300047443 Bacteria 12673
107 Ga0495687_006715 3300047443 Bacteria 6975
108 Ga0495675_0065594 3300047444 Bacteria 2296
109 Ga0495685_000375 3300047447 Bacteria 14218
110 Ga0495685_007513 3300047447 Bacteria 3601
111 Ga0495685_017511 3300047447 Bacteria 2454
112 Ga0495685_029520 3300047447 Bacteria 1885
113 Ga0495685_075995 3300047447 Bacteria 1122
114 Ga0495681_0019899 3300047470 Bacteria 3652
115 Ga0495686_0101713 3300047472 Bacteria 1732
116 Ga0495593_0000738 3300047673 Bacteria 18987
117 Ga0495602_0019065 3300048088 Bacteria 6825
118 Ga0495602_0165165 3300048088 Bacteria 1724
119 Ga0495614_0013770 3300048089 Bacteria 3546
120 Ga0495614_0034104 3300048089 Bacteria 2189
121 Ga0495626_0001053 3300048091 Bacteria 23578
122 Ga0495678_028122 3300049459 Bacteria 2377
123 Ga0501034_0049378 3300049571 Bacteria 4245
124 Ga0501036_0010701 3300049572 Bacteria 7583
125 Ga0501038_0045725 3300049574 Bacteria 3799
126 Ga0501035_0153022 3300049822 Bacteria 2001
127 Ga0501044_0020467 3300049823 Bacteria 7065
128 Ga0501044_0256964 3300049823 Bacteria 1686
129 Ga0500583_0027437 3300053092 Bacteria 2458
130 Ga0500654_096487 3300053099 Bacteria 1285
131 Ga0500572_040736 3300053111 Bacteria 1346
132 2547409382 2547132111 Bacteria 8013147
133 2585303198 2582581313 Bacteria 10042643
134 2585312560 2582581314 Bacteria 11452267
135 2616697190 2616644814 Bacteria 11555299
136 2643762280 2643221548 Bacteria 8053412
137 2643942007 2643221587 Bacteria 7586415
138 2644013993 2643221601 Bacteria 7493239
139 2644174445 2643221631 Bacteria 8168043
140 2644266845 2643221647 Bacteria 10741251
141 2644389636 2643221670 Bacteria 6497041
142 2644429090 2643221677 Bacteria 7584031
143 2644458941 2643221682 Bacteria 6743283
144 2784592345 2784132148 Bacteria 8627943
145 2785365698 2784746768 Bacteria 10036182
146 2786674264 2786546132 Bacteria 10419719
147 2808917013 2808606375 Bacteria 9466072
148 2809235975 2808606448 Bacteria 8656184
149 2812483109 2811994917 Bacteria 7761064
150 2816422113 2816332119 Bacteria 8120218
151 2862283827 2862281513 Bacteria 9621493
152 2862515862 2862507626 Bacteria 9425308
153 2862577626 2862574272 Bacteria 10567477
154 2863408168 2863404153 Bacteria 9672205
155 2867434141 2867428634 Bacteria 9590268
156 2877677020 2877676314 Bacteria 9512378
157 2891332263 2891326441 Bacteria 6439512
158 2912715260 2912715099 Bacteria 9460473
159 2912759799 2912757875 Bacteria 7940295
160 2954381430 2954380949 Bacteria 10050426
161 2954381926 2954380949 Bacteria 10050426
162 2954681147 2954673503 Bacteria 9685905
163 2954683010 2954682443 Bacteria 9862841
164 2954692735 2954691527 Bacteria 10720516
165 2954707808 2954701450 Bacteria 10834262
166 2954712389 2954711539 Bacteria 10867210
167 2954722337 2954721474 Bacteria 10456478
168 2954739514 2954731030 Bacteria 10243860
169 2954741223 2954740390 Bacteria 10229294
170 2954758341 2954749733 Bacteria 10366972
171 2954760234 2954759201 Bacteria 9358192
172 2966599642 2966598605 Bacteria 7676064
173 2995469903 2995463766 Bacteria 8577691
174 3006499189 3006493962 Bacteria 8825450
175 8023626631 8023623736 Bacteria 8593882
176 8025531189 8025530807 Bacteria 8495698
177 Ga0451853_0097713
178 rootH1_10068344
179 rootH2_10107651
180 rootH1_10011819
181 Ga0006562J51391_1159950
182 Ga0105244_10185738
183 Ga0105246_10002495
184 Ga0157372_10722018
185 Ga0183367_1004
186 Ga0209758_1003720
187 Ga0307515_10007816
188 Ga0307511_10000186
189 Ga0307512_10038832
190 Ga0307513_10171686
191 Ga0307509_10059664
192 Ga0307509_10109038
193 Ga0307514_10061381
194 Ga0307514_10248420
195 Ga0307516_10012656
196 Ga0307518_10008633
197 Ga0307518_10049995
198 Ga0307518_10225189
199 Ga0307507_10049480
200 Ga0307510_10137831
201 Ga0451807_0815885
202 Ga0451837_1752382
203 Ga0451845_0702907
204 Ga0451853_0003332
205 Ga0451853_1236331
206 Ga0451853_2125091
207 Ga0439448_0002260
208 Ga0450894_000179
209 Ga0450903_000789
210 Ga0450903_014461
211 Ga0439458_0003071
212 Ga0450908_004497
213 Ga0466972_0007230
214 Ga0466972_0007427
215 Ga0466966_0053305
216 Ga0466966_0140211
217 Ga0466961_0004976
218 Ga0466960_0248338
219 Ga0495592_0035590
220 Ga0495603_0015011
221 Ga0495638_0028918
222 Ga0495582_0162139
223 Ga0495605_0002404
224 Ga0495662_0025263
225 Ga0495664_0000517
226 Ga0495585_0014133
227 Ga0495594_0071047
228 Ga0495596_0117197
229 Ga0495606_0000332
230 Ga0495606_0116302
231 Ga0495608_0032219
232 Ga0495616_0050844
233 Ga0495618_0012361
234 Ga0495620_0013025
235 Ga0495620_0112729
236 Ga0495628_0076154
237 Ga0495631_0006400
238 Ga0495632_0133634
239 Ga0495666_0030365
240 Ga0495652_0009749
241 Ga0495654_0071993
242 Ga0495640_0017254
243 Ga0495587_0000603
244 Ga0495645_0024479
245 Ga0495622_0013626
246 Ga0495633_0115902
247 Ga0495667_0040552
248 Ga0495668_0002578
249 Ga0495634_0023854
250 Ga0495634_0063825
251 Ga0495611_0021261
252 Ga0495625_0004292
253 Ga0495625_0004735
254 Ga0495635_0209508
255 Ga0495661_0020531
256 Ga0495588_0011355
257 Ga0495657_0005134
258 Ga0495657_0012807
259 Ga0495599_0149912
260 Ga0495623_0060532
261 Ga0495613_0004450
262 Ga0495613_0083971
263 Ga0495670_0043029
264 Ga0495671_0052273
265 Ga0495649_0005350
266 Ga0495589_0021682
267 Ga0495600_0004141
268 Ga0495581_0080412
269 Ga0495604_0019983
270 Ga0495604_0135586
271 Ga0495636_0104826
272 Ga0495636_0124882
273 Ga0495636_0190143
274 Ga0495674_0192179
275 Ga0495676_0012101
276 Ga0495676_0046388
277 Ga0495676_0090397
278 Ga0495680_0018130
279 Ga0495683_0032108
280 Ga0495683_0069144
281 Ga0495687_001612
282 Ga0495687_003019
283 Ga0495687_006715
284 Ga0495675_0065594
285 Ga0495685_000375
286 Ga0495685_007513
287 Ga0495685_017511
288 Ga0495685_029520
289 Ga0495685_075995
290 Ga0495681_0019899
291 Ga0495686_0101713
292 Ga0495593_0000738
293 Ga0495602_0019065
294 Ga0495602_0165165
295 Ga0495614_0013770
296 Ga0495614_0034104
297 Ga0495626_0001053
298 Ga0495678_028122
299 Ga0501034_0049378
300 Ga0501036_0010701
301 Ga0501038_0045725
302 Ga0501035_0153022
303 Ga0501044_0020467
304 Ga0501044_0256964
305 Ga0500583_0027437
306 Ga0500654_096487
307 Ga0500572_040736
308 2547409382
309 2585303198
310 2585312560
311 2616697190
312 2643762280
313 2643942007
314 2644013993
315 2644174445
316 2644266845
317 2644389636
318 2644429090
319 2644458941
320 2784592345
321 2785365698
322 2786674264
323 2808917013
324 2809235975
325 2812483109
326 2816422113
327 2862283827
328 2862515862
329 2862577626
330 2863408168
331 2867434141
332 2877677020
333 2891332263
334 2912715260
335 2912759799
336 2954381430
337 2954381926
338 2954681147
339 2954683010
340 2954692735
341 2954707808
342 2954712389
343 2954722337
344 2954739514
345 2954741223
346 2954758341
347 2954760234
348 2966599642
349 2995469903
350 3006499189
351 8023626631
352 8025531189

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cp9-assembly4.cif.gz_G contact-dependent growth inhibition toxin - immunity protein complex from klebsiella pneumoniae 342 0.804 222 240
6jil-assembly1.cif.gz_A crystal structure of d-cycloserine synthetase dcsg 0.7693 6 268
5cge-assembly2.cif.gz_E structure of hydroxyethylthiazole kinase thim from staphylococcus aureus in complex with substrate analog 2-(2-methyl-1h-imidazole-1-yl)ethanol 0.7345 4 86
5cge-assembly2.cif.gz_F structure of hydroxyethylthiazole kinase thim from staphylococcus aureus in complex with substrate analog 2-(2-methyl-1h-imidazole-1-yl)ethanol 0.7339 4 86
6jil-assembly1.cif.gz_A crystal structure of d-cycloserine synthetase dcsg 0.73 6 268
ID Description Score Start End Superfamily
af_Q7KTZ4_11_152_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7564 223 247 2.130.10.10
af_P87229_162_345_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7425 223 246 2.130.10.10
af_A0A0P0VN26_465_565_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7373 220 245 3.30.420.10
3vpcC03 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.734 169 268 3.30.470.20
5cgeF00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.7339 4 86 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A023PFS0-F1-model_v4 deleted 0.9663 165 273
AF-A0A8A9I327-F1-model_v4 deleted 0.9605 150 274
AF-A0A3R9XL67-F1-model_v4 deleted 0.9515 155 270
AF-A0A7K2PZI2-F1-model_v4 ATP-grasp domain-containing protein 0.9476 1 274
AF-A0A1C5CHP3-F1-model_v4 Glutathione synthase/RimK-type ligase, ATP-grasp superfamily 0.9465 5 272

Map