F268545

General Info

Members Datasets Scaffolds Average Seq Length
176 145 176 202

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100233307|Ga0307408_1002333071
Length 229
Sequence MRGGSVRSEPVDRECDTLAVDDPAIGVLISGRGSNLQALIDAIRDGRLRARIAIVISNKANAPGLLRAERVGIETLVLDHRPAPSRDAYDRQLAEELRVRDVRLVCLAGFMRLIGPPLLEAFPNAILNVHGVNAQRQALTHGVKVTGATVHLVTSELDGGPILLQAAVPVLDDDSEDTLSARILEEEHRLYPRAVRMMLEGNWLLHGRRCVARSVTATSSDQKMPGTSR

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
85 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
95 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
96 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
97 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
98 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
101 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
107 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
108 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
124 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
136 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
137 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
138 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
139 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
142 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
143 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
144 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
145 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.11
Nodule 0
Rhizoplane 7.39
Rhizosphere 85.8
Stem 0
Stem Tuber 0
Unclassified 1.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10018274 3300002459 Unclassified 1450
2 rootL2_10331247 3300003322 Bacteria 1383
3 Ga0065715_10572678 3300005293 Bacteria 726
4 Ga0070658_10325932 3300005327 Bacteria 1312
5 Ga0070658_10525451 3300005327 Bacteria 1023
6 Ga0070658_10550932 3300005327 Bacteria 998
7 Ga0070676_10005204 3300005328 Bacteria 6913
8 Ga0070683_100000219 3300005329 Bacteria 39225
9 Ga0070670_100021126 3300005331 Bacteria 5599
10 Ga0070670_100031172 3300005331 Bacteria 4592
11 Ga0070666_10628674 3300005335 Bacteria 784
12 Ga0070682_100249298 3300005337 Unclassified 1279
13 Ga0070682_100292255 3300005337 Bacteria 1192
14 Ga0070660_100329166 3300005339 Unclassified 1256
15 Ga0070689_100327353 3300005340 Bacteria 1281
16 Ga0070661_100019594 3300005344 Bacteria 4822
17 Ga0070671_100079935 3300005355 Bacteria 2733
18 Ga0070674_100226901 3300005356 Bacteria 1456
19 Ga0070659_100045846 3300005366 Bacteria 3426
20 Ga0070714_100128097 3300005435 Bacteria 2266
21 Ga0070713_100667929 3300005436 Bacteria 990
22 Ga0070663_100019435 3300005455 Bacteria 4478
23 Ga0070662_100059335 3300005457 Bacteria 2787
24 Ga0070681_10179599 3300005458 Bacteria 2038
25 Ga0070706_100934133 3300005467 Bacteria 801
26 Ga0070699_100173144 3300005518 Bacteria 1913
27 Ga0070684_100004177 3300005535 Bacteria 10942
28 Ga0070665_100102592 3300005548 Unclassified 2864
29 Ga0070665_100312528 3300005548 Bacteria 1575
30 Ga0068855_100077534 3300005563 Bacteria 3856
31 Ga0070664_100005403 3300005564 Bacteria 10256
32 Ga0070664_100079170 3300005564 Bacteria 2828
33 Ga0068856_100039160 3300005614 Bacteria 4654
34 Ga0068864_100095356 3300005618 Bacteria 2631
35 Ga0068864_100857833 3300005618 Bacteria 895
36 Ga0068866_10107696 3300005718 Unclassified 1549
37 Ga0068861_100494710 3300005719 Bacteria 1104
38 Ga0068858_100535274 3300005842 Bacteria 1134
39 Ga0075368_10039697 3300006042 Bacteria 1846
40 Ga0075363_100209191 3300006048 Bacteria 1116
41 Ga0075363_100327312 3300006048 Bacteria 892
42 Ga0070715_10251880 3300006163 Bacteria 923
43 Ga0075366_10002470 3300006195 Bacteria 9469
44 Ga0097621_100036705 3300006237 Bacteria 3922
45 Ga0075370_10127804 3300006353 Bacteria 1482
46 Ga0068871_101103755 3300006358 Bacteria 742
47 Ga0075428_100265801 3300006844 Bacteria 1846
48 Ga0075428_100340766 3300006844 Bacteria 1610
49 Ga0075431_100153227 3300006847 Bacteria 2373
50 Ga0075434_100517820 3300006871 Bacteria 1213
51 Ga0105240_10001577 3300009093 Bacteria 38667
52 Ga0111539_10000364 3300009094 Bacteria 55762
53 Ga0105242_10272892 3300009176 Bacteria 1533
54 Ga0105242_10681147 3300009176 Bacteria 1004
55 Ga0105248_10064726 3300009177 Bacteria 4104
56 Ga0105248_10128188 3300009177 Bacteria 2862
57 Ga0105237_10021283 3300009545 Bacteria 6669
58 Ga0105238_11120682 3300009551 Bacteria 810
59 Ga0105239_10305174 3300010375 Bacteria 1793
60 Ga0105239_11262856 3300010375 Bacteria 852
61 Ga0157370_10038103 3300013104 Bacteria 4653
62 Ga0157369_10008465 3300013105 Bacteria 11798
63 Ga0157374_10183090 3300013296 Bacteria 2047
64 Ga0163162_10967700 3300013306 Bacteria 962
65 Ga0157372_10115343 3300013307 Bacteria 3080
66 Ga0157375_10091270 3300013308 Bacteria 3107
67 Ga0163163_10000042 3300014325 Bacteria 138794
68 Ga0163163_10064148 3300014325 Bacteria 3645
69 Ga0157380_10259649 3300014326 Bacteria 1577
70 Ga0157380_10824640 3300014326 Bacteria 947
71 Ga0157376_10070654 3300014969 Bacteria 2964
72 Ga0157376_10508435 3300014969 Bacteria 1185
73 Ga0207642_10061869 3300025899 Bacteria 1743
74 Ga0207645_10026369 3300025907 Unclassified 3756
75 Ga0207705_10259314 3300025909 Bacteria 1327
76 Ga0207707_10172517 3300025912 Bacteria 1890
77 Ga0207695_10002352 3300025913 Bacteria 28101
78 Ga0207671_10257203 3300025914 Unclassified 1373
79 Ga0207649_10006738 3300025920 Bacteria 6240
80 Ga0207650_10034208 3300025925 Bacteria 3685
81 Ga0207650_10075745 3300025925 Bacteria 2540
82 Ga0207700_10557970 3300025928 Bacteria 1017
83 Ga0207664_10118730 3300025929 Bacteria 2210
84 Ga0207644_10139370 3300025931 Bacteria 1866
85 Ga0207690_10025257 3300025932 Bacteria 3728
86 Ga0207706_10082868 3300025933 Bacteria 2819
87 Ga0207686_10126732 3300025934 Bacteria 1746
88 Ga0207711_10074724 3300025941 Bacteria 2948
89 Ga0207661_10005019 3300025944 Bacteria 9278
90 Ga0207679_10015458 3300025945 Bacteria 5044
91 Ga0207679_10080000 3300025945 Bacteria 2494
92 Ga0207667_10061796 3300025949 Bacteria 3918
93 Ga0207703_10497884 3300026035 Bacteria 1143
94 Ga0207639_10322160 3300026041 Bacteria 1373
95 Ga0207678_10038069 3300026067 Bacteria 4181
96 Ga0207648_10064627 3300026089 Bacteria 3189
97 Ga0207676_10090997 3300026095 Bacteria 2505
98 Ga0207676_10588332 3300026095 Bacteria 1068
99 Ga0207674_10135888 3300026116 Bacteria 2421
100 Ga0207675_100121400 3300026118 Bacteria 2473
101 Ga0207698_10117140 3300026142 Bacteria 2247
102 Ga0209813_10008263 3300027866 Bacteria 2623
103 Ga0265325_10047984 3300031241 Unclassified 2209
104 Ga0265316_10005096 3300031344 Bacteria 12873
105 Ga0265316_10007141 3300031344 Bacteria 10560
106 Ga0265316_10322270 3300031344 Bacteria 1122
107 Ga0307408_100008001 3300031548 Bacteria 6989
108 Ga0307408_100233307 3300031548 Bacteria 1508
109 Ga0265342_10034372 3300031712 Bacteria 3110
110 Ga0307413_10397214 3300031824 Bacteria 1079
111 Ga0307410_10055916 3300031852 Bacteria 2681
112 Ga0307407_10037094 3300031903 Bacteria 2691
113 Ga0307416_100212053 3300032002 Bacteria 1848
114 Ga0307411_10026713 3300032005 Bacteria 3480
115 Ga0373934_0004828 3300035086 Bacteria 4987
116 Ga0373956_0004812 3300035119 Bacteria 5399
117 Ga0373957_0005244 3300035120 Bacteria 4011
118 Ga0373946_0149418 3300035171 Bacteria 1089
119 Ga0373955_0002132 3300035172 Bacteria 8546
120 Ga0373927_0231849 3300035695 Bacteria 1213
121 Ga0373933_0017187 3300035724 Bacteria 4055
122 Ga0373947_0139311 3300035725 Bacteria 1555
123 Ga0373937_0032913 3300036401 Bacteria 4703
124 Ga0373937_0526798 3300036401 Bacteria 1123
125 Ga0373937_0769355 3300036401 Bacteria 910
126 Ga0436364_0047123 3300037853 Unclassified 3389
127 Ga0395901_1209835 3300038443 Unclassified 721
128 Ga0395901_1314210 3300038443 Bacteria 684
129 Ga0436365_0448621 3300039437 Unclassified 1614
130 Ga0439445_0017828 3300042004 Bacteria 1758
131 Ga0439435_0001782 3300042436 Bacteria 4102
132 Ga0453683_0117060 3300044673 Bacteria 1677
133 Ga0466963_0496252 3300044694 Unclassified 862
134 Ga0466971_0180648 3300044719 Bacteria 992
135 Ga0466959_0187350 3300045049 Bacteria 1445
136 Ga0451576_0061210 3300045051 Bacteria 3926
137 Ga0451576_0098980 3300045051 Bacteria 3033
138 Ga0466967_0155268 3300045976 Bacteria 2143
139 Ga0495651_0084127 3300046462 Bacteria 2398
140 Ga0495580_0028484 3300046472 Bacteria 4060
141 Ga0495582_0363237 3300046473 Bacteria 834
142 Ga0495664_0242151 3300046477 Bacteria 1091
143 Ga0495628_0604713 3300046516 Bacteria 783
144 Ga0495621_0223671 3300046539 Bacteria 762
145 Ga0495634_0227986 3300046642 Bacteria 1147
146 Ga0495635_0428085 3300046663 Bacteria 877
147 Ga0495658_0033261 3300046683 Bacteria 2822
148 Ga0495658_0146935 3300046683 Bacteria 1445
149 Ga0495658_0305372 3300046683 Bacteria 1007
150 Ga0495676_0029927 3300047321 Bacteria 4629
151 Ga0495684_0242696 3300047471 Bacteria 1313
152 Ga0496104_0010197 3300048907 Bacteria 8388
153 Ga0496104_0012179 3300048907 Bacteria 7725
154 Ga0496105_0010021 3300048908 Bacteria 7436
155 Ga0496105_0047755 3300048908 Bacteria 3533
156 Ga0496106_0228481 3300048909 Bacteria 1485
157 Ga0496108_0001066 3300048911 Bacteria 21388
158 Ga0496109_0000525 3300048912 Bacteria 32426
159 Ga0496110_0001750 3300048913 Bacteria 16012
160 Ga0496110_0182965 3300048913 Bacteria 1903
161 Ga0496111_0000267 3300048914 Bacteria 25489
162 Ga0496112_0004758 3300048915 Bacteria 11577
163 Ga0496114_0028776 3300048917 Bacteria 4562
164 Ga0496115_0132663 3300048918 Bacteria 2053
165 Ga0501041_0791361 3300049577 Bacteria 608
166 nmdc:mga06z11_456908_c1 3300050494 Bacteria 772
167 nmdc:mga04h51_19624_c1 3300050495 Bacteria 2007
168 nmdc:mga07m45_370642_c1 3300050496 Bacteria 832
169 nmdc:mga0qj67_463295_c1 3300050509 Bacteria 1020
170 nmdc:mga06r32_807644_c1 3300050510 Unclassified 898
171 Ga0495601_0009640 3300053077 Bacteria 5716
172 Ga0495595_0003230 3300053084 Bacteria 6474
173 Ga0495619_0062757 3300053085 Bacteria 2474
174 Ga0495619_0293852 3300053085 Bacteria 1126
175 Ga0590071_028577 3300059421 Bacteria 1325
176 Ga0590077_027356 3300059426 Bacteria 1235

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005436 Ga0070713_100667929 Ga0070713_1006679291 172
2 3300025928 Ga0207700_10557970 Ga0207700_105579702 172
3 3300046516 Ga0495628_0604713 Ga0495628_0604713_242_772 175
4 3300049577 Ga0501041_0791361 Ga0501041_0791361_16_552 178
5 3300026035 Ga0207703_10497884 Ga0207703_104978842 179
6 3300045051 Ga0451576_0098980 Ga0451576_0098980_1940_2509 179
7 3300005618 Ga0068864_100857833 Ga0068864_1008578331 187
8 3300005842 Ga0068858_100535274 Ga0068858_1005352742 187
9 3300006358 Ga0068871_101103755 Ga0068871_1011037552 187
10 3300014325 Ga0163163_10000042 Ga0163163_100000428 187
11 3300048913 Ga0496110_0182965 Ga0496110_0182965_517_1086 187
12 3300005293 Ga0065715_10572678 Ga0065715_105726781 188
13 3300005329 Ga0070683_100000219 Ga0070683_1000002196 188
14 3300005331 Ga0070670_100021126 Ga0070670_1000211265 188
15 3300005335 Ga0070666_10628674 Ga0070666_106286741 188
16 3300005340 Ga0070689_100327353 Ga0070689_1003273531 188
17 3300005344 Ga0070661_100019594 Ga0070661_1000195943 188
18 3300005355 Ga0070671_100079935 Ga0070671_1000799352 188
19 3300005455 Ga0070663_100019435 Ga0070663_1000194354 188
20 3300005457 Ga0070662_100059335 Ga0070662_1000593352 188
21 3300005535 Ga0070684_100004177 Ga0070684_1000041776 188
22 3300005564 Ga0070664_100005403 Ga0070664_1000054035 188
23 3300005618 Ga0068864_100095356 Ga0068864_1000953562 188
24 3300009177 Ga0105248_10128188 Ga0105248_101281883 188
25 3300010375 Ga0105239_11262856 Ga0105239_112628562 188
26 3300013296 Ga0157374_10183090 Ga0157374_101830902 188
27 3300014325 Ga0163163_10064148 Ga0163163_100641484 188
28 3300025920 Ga0207649_10006738 Ga0207649_100067383 188
29 3300025925 Ga0207650_10075745 Ga0207650_100757452 188
30 3300025931 Ga0207644_10139370 Ga0207644_101393702 188
31 3300025933 Ga0207706_10082868 Ga0207706_100828682 188
32 3300025941 Ga0207711_10074724 Ga0207711_100747242 188
33 3300025944 Ga0207661_10005019 Ga0207661_100050198 188
34 3300026067 Ga0207678_10038069 Ga0207678_100380692 188
35 3300026095 Ga0207676_10090997 Ga0207676_100909972 188
36 3300048907 Ga0496104_0012179 Ga0496104_0012179_3065_3658 188
37 3300048908 Ga0496105_0010021 Ga0496105_0010021_2221_2814 188
38 3300048909 Ga0496106_0228481 Ga0496106_0228481_577_1170 188
39 3300048911 Ga0496108_0001066 Ga0496108_0001066_3371_3964 188
40 3300048912 Ga0496109_0000525 Ga0496109_0000525_3824_4417 188
41 3300048913 Ga0496110_0001750 Ga0496110_0001750_477_1070 188
42 3300048914 Ga0496111_0000267 Ga0496111_0000267_4373_4966 188
43 3300048915 Ga0496112_0004758 Ga0496112_0004758_7129_7722 188
44 3300059421 Ga0590071_028577 Ga0590071_028577_273_902 188
45 3300005366 Ga0070659_100045846 Ga0070659_1000458463 192
46 3300025932 Ga0207690_10025257 Ga0207690_100252572 192
47 3300046663 Ga0495635_0428085 Ga0495635_0428085_171_794 192
48 3300050509 nmdc:mga0qj67_463295_c1 nmdc:mga0qj67_463295_c1_36_638 192
49 3300003322 rootL2_10331247 rootL2_103312472 193
50 3300053085 Ga0495619_0293852 Ga0495619_0293852_472_1095 194
51 3300059426 Ga0590077_027356 Ga0590077_027356_287_916 194
52 3300005327 Ga0070658_10325932 Ga0070658_103259322 195
53 3300005328 Ga0070676_10005204 Ga0070676_100052042 195
54 3300005337 Ga0070682_100249298 Ga0070682_1002492982 195
55 3300005337 Ga0070682_100292255 Ga0070682_1002922552 195
56 3300005548 Ga0070665_100102592 Ga0070665_1001025922 195
57 3300005548 Ga0070665_100312528 Ga0070665_1003125282 195
58 3300005564 Ga0070664_100079170 Ga0070664_1000791703 195
59 3300005718 Ga0068866_10107696 Ga0068866_101076962 195
60 3300009176 Ga0105242_10681147 Ga0105242_106811472 195
61 3300009551 Ga0105238_11120682 Ga0105238_111206821 195
62 3300010375 Ga0105239_10305174 Ga0105239_103051742 195
63 3300013306 Ga0163162_10967700 Ga0163162_109677002 195
64 3300025899 Ga0207642_10061869 Ga0207642_100618693 195
65 3300025907 Ga0207645_10026369 Ga0207645_100263694 195
66 3300025934 Ga0207686_10126732 Ga0207686_101267321 195
67 3300025945 Ga0207679_10015458 Ga0207679_100154584 195
68 3300025945 Ga0207679_10080000 Ga0207679_100800003 195
69 3300026089 Ga0207648_10064627 Ga0207648_100646274 195
70 3300026116 Ga0207674_10135888 Ga0207674_101358883 195
71 3300042004 Ga0439445_0017828 Ga0439445_0017828_440_1075 195
72 3300044673 Ga0453683_0117060 Ga0453683_0117060_133_753 195
73 3300045051 Ga0451576_0061210 Ga0451576_0061210_1419_2039 195
74 3300031548 Ga0307408_100233307 Ga0307408_1002333071 196
75 3300031824 Ga0307413_10397214 Ga0307413_103972142 196
76 3300031852 Ga0307410_10055916 Ga0307410_100559164 196
77 3300032005 Ga0307411_10026713 Ga0307411_100267133 196
78 3300042436 Ga0439435_0001782 Ga0439435_0001782_2717_3385 196
79 3300046477 Ga0495664_0242151 Ga0495664_0242151_43_633 196
80 3300046539 Ga0495621_0223671 Ga0495621_0223671_143_736 196
81 3300005327 Ga0070658_10525451 Ga0070658_105254511 199
82 3300005327 Ga0070658_10550932 Ga0070658_105509321 199
83 3300005339 Ga0070660_100329166 Ga0070660_1003291661 199
84 3300005435 Ga0070714_100128097 Ga0070714_1001280972 199
85 3300005458 Ga0070681_10179599 Ga0070681_101795992 199
86 3300005563 Ga0068855_100077534 Ga0068855_1000775344 199
87 3300005614 Ga0068856_100039160 Ga0068856_1000391606 199
88 3300009093 Ga0105240_10001577 Ga0105240_1000157711 199
89 3300009545 Ga0105237_10021283 Ga0105237_100212835 199
90 3300013104 Ga0157370_10038103 Ga0157370_100381034 199
91 3300013105 Ga0157369_10008465 Ga0157369_1000846512 199
92 3300013307 Ga0157372_10115343 Ga0157372_101153432 199
93 3300025909 Ga0207705_10259314 Ga0207705_102593142 199
94 3300025912 Ga0207707_10172517 Ga0207707_101725172 199
95 3300025913 Ga0207695_10002352 Ga0207695_1000235220 199
96 3300025914 Ga0207671_10257203 Ga0207671_102572032 199
97 3300025929 Ga0207664_10118730 Ga0207664_101187302 199
98 3300025949 Ga0207667_10061796 Ga0207667_100617962 199
99 3300026142 Ga0207698_10117140 Ga0207698_101171402 199
100 3300031241 Ga0265325_10047984 Ga0265325_100479842 199
101 3300031344 Ga0265316_10007141 Ga0265316_100071419 199
102 3300031344 Ga0265316_10322270 Ga0265316_103222702 199
103 3300031712 Ga0265342_10034372 Ga0265342_100343723 199
104 3300035695 Ga0373927_0231849 Ga0373927_0231849_105_704 199
105 3300037853 Ga0436364_0047123 Ga0436364_0047123_242_841 199
106 3300038443 Ga0395901_1209835 Ga0395901_1209835_31_636 199
107 3300039437 Ga0436365_0448621 Ga0436365_0448621_773_1384 199
108 3300044694 Ga0466963_0496252 Ga0466963_0496252_61_666 199
109 3300044719 Ga0466971_0180648 Ga0466971_0180648_76_681 199
110 3300045049 Ga0466959_0187350 Ga0466959_0187350_151_756 199
111 3300045976 Ga0466967_0155268 Ga0466967_0155268_321_926 199
112 3300046472 Ga0495580_0028484 Ga0495580_0028484_58_657 199
113 3300048907 Ga0496104_0010197 Ga0496104_0010197_7592_8332 199
114 3300048908 Ga0496105_0047755 Ga0496105_0047755_217_933 199
115 3300048917 Ga0496114_0028776 Ga0496114_0028776_1336_2076 199
116 3300048918 Ga0496115_0132663 Ga0496115_0132663_216_956 199
117 3300009177 Ga0105248_10064726 Ga0105248_100647263 200
118 3300031344 Ga0265316_10005096 Ga0265316_100050967 200
119 3300035171 Ga0373946_0149418 Ga0373946_0149418_92_694 200
120 3300035725 Ga0373947_0139311 Ga0373947_0139311_667_1269 200
121 3300036401 Ga0373937_0769355 Ga0373937_0769355_100_702 200
122 3300046683 Ga0495658_0146935 Ga0495658_0146935_230_832 200
123 3300047471 Ga0495684_0242696 Ga0495684_0242696_553_1155 200
124 3300053077 Ga0495601_0009640 Ga0495601_0009640_2571_3173 200
125 3300053084 Ga0495595_0003230 Ga0495595_0003230_4593_5195 200
126 3300006237 Ga0097621_100036705 Ga0097621_1000367053 202
127 3300006844 Ga0075428_100265801 Ga0075428_1002658012 202
128 3300006847 Ga0075431_100153227 Ga0075431_1001532272 202
129 3300009176 Ga0105242_10272892 Ga0105242_102728922 202
130 3300013308 Ga0157375_10091270 Ga0157375_100912703 202
131 3300014969 Ga0157376_10070654 Ga0157376_100706542 202
132 3300026041 Ga0207639_10322160 Ga0207639_103221602 202
133 3300026095 Ga0207676_10588332 Ga0207676_105883321 202
134 3300031548 Ga0307408_100008001 Ga0307408_1000080012 202
135 3300035086 Ga0373934_0004828 Ga0373934_0004828_1855_2484 202
136 3300035119 Ga0373956_0004812 Ga0373956_0004812_3801_4430 202
137 3300035120 Ga0373957_0005244 Ga0373957_0005244_1129_1758 202
138 3300035172 Ga0373955_0002132 Ga0373955_0002132_2787_3416 202
139 3300035724 Ga0373933_0017187 Ga0373933_0017187_3390_4019 202
140 3300036401 Ga0373937_0032913 Ga0373937_0032913_3677_4306 202
141 3300036401 Ga0373937_0526798 Ga0373937_0526798_416_1024 202
142 3300046462 Ga0495651_0084127 Ga0495651_0084127_625_1257 202
143 3300050494 nmdc:mga06z11_456908_c1 nmdc:mga06z11_456908_c1_89_715 202
144 3300050510 nmdc:mga06r32_807644_c1 nmdc:mga06r32_807644_c1_113_739 202
145 3300005467 Ga0070706_100934133 Ga0070706_1009341331 203
146 3300005719 Ga0068861_100494710 Ga0068861_1004947101 203
147 3300006042 Ga0075368_10039697 Ga0075368_100396972 203
148 3300006048 Ga0075363_100209191 Ga0075363_1002091911 203
149 3300006048 Ga0075363_100327312 Ga0075363_1003273122 203
150 3300006163 Ga0070715_10251880 Ga0070715_102518801 203
151 3300006195 Ga0075366_10002470 Ga0075366_100024705 203
152 3300006353 Ga0075370_10127804 Ga0075370_101278042 203
153 3300006871 Ga0075434_100517820 Ga0075434_1005178201 203
154 3300009094 Ga0111539_10000364 Ga0111539_100003645 203
155 3300014326 Ga0157380_10824640 Ga0157380_108246402 203
156 3300014969 Ga0157376_10508435 Ga0157376_105084352 203
157 3300027866 Ga0209813_10008263 Ga0209813_100082633 203
158 3300031903 Ga0307407_10037094 Ga0307407_100370942 203
159 3300032002 Ga0307416_100212053 Ga0307416_1002120531 203
160 3300046473 Ga0495582_0363237 Ga0495582_0363237_65_721 203
161 3300046642 Ga0495634_0227986 Ga0495634_0227986_519_1130 203
162 3300046683 Ga0495658_0033261 Ga0495658_0033261_315_971 203
163 3300046683 Ga0495658_0305372 Ga0495658_0305372_118_729 203
164 3300047321 Ga0495676_0029927 Ga0495676_0029927_2984_3640 203
165 3300050495 nmdc:mga04h51_19624_c1 nmdc:mga04h51_19624_c1_144_779 203
166 3300050496 nmdc:mga07m45_370642_c1 nmdc:mga07m45_370642_c1_181_816 203
167 3300053085 Ga0495619_0062757 Ga0495619_0062757_736_1347 203
168 3300002459 JGI24751J29686_10018274 JGI24751J29686_100182742 204
169 3300005331 Ga0070670_100031172 Ga0070670_1000311724 204
170 3300005356 Ga0070674_100226901 Ga0070674_1002269012 204
171 3300005518 Ga0070699_100173144 Ga0070699_1001731442 204
172 3300006844 Ga0075428_100340766 Ga0075428_1003407662 204
173 3300014326 Ga0157380_10259649 Ga0157380_102596492 204
174 3300025925 Ga0207650_10034208 Ga0207650_100342083 204
175 3300026118 Ga0207675_100121400 Ga0207675_1001214003 204
176 3300038443 Ga0395901_1314210 Ga0395901_1314210_18_674 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

24

195

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ywr-assembly1.cif.gz_A crystal structure of gar transformylase from aquifex aeolicus 0.9648 5 201
1c2t-assembly1.cif.gz_A new insights into inhibitor design from the crystal structure and nmr studies of e. coli gar transformylase in complex with beta-gar and 10-formyl-5,8,10-trideazafolic acid. 0.952 6 202
3auf-assembly1.cif.gz_A-2 crystal structure of glycinamide ribonucleotide transformylase 1 from symbiobacterium toebii 0.9511 1 203
3tqr-assembly1.cif.gz_A structure of the phosphoribosylglycinamide formyltransferase (purn) in complex with ches from coxiella burnetii 0.9509 4 202
3auf-assembly1.cif.gz_A-2 crystal structure of glycinamide ribonucleotide transformylase 1 from symbiobacterium toebii 0.9466 1 203
ID Description Score Start End Superfamily
af_Q2FZI7_1_188_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9667 5 189 3.40.50.170
2ywrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9626 6 201 3.40.50.170
3aufA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9511 1 203 3.40.50.170
af_Q2FZI7_1_188_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9467 5 189 3.40.50.170
3aufA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9466 1 203 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A2V8G8Z8-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9765 28 201 GO:0004644
GO:0005829
GO:0006189
AF-A0A7V9CNL6-F1-model_v4 phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) 0.9736 1 93 GO:0004644
GO:0005737
GO:0006189
AF-A0A550JKQ1-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9707 1 201 GO:0004644
GO:0005829
GO:0006189
AF-A0A350CZ61-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) 0.9667 6 179 GO:0004644
GO:0005829
GO:0006189
AF-A0A1V1RGY4-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9644 1 203 GO:0004644
GO:0005829
GO:0006189
GO:0006730
GO:0008864

Feature Viewer

pLDDT pTM Quality
92.74 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map