F268545
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 176 | 145 | 176 | 202 |
Family's Representative Sequence
| Representative Sequence | 3300031548|Ga0307408_100233307|Ga0307408_1002333071 |
| Length | 229 |
| Sequence | MRGGSVRSEPVDRECDTLAVDDPAIGVLISGRGSNLQALIDAIRDGRLRARIAIVISNKANAPGLLRAERVGIETLVLDHRPAPSRDAYDRQLAEELRVRDVRLVCLAGFMRLIGPPLLEAFPNAILNVHGVNAQRQALTHGVKVTGATVHLVTSELDGGPILLQAAVPVLDDDSEDTLSARILEEEHRLYPRAVRMMLEGNWLLHGRRCVARSVTATSSDQKMPGTSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 29 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 30 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 31 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 32 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 33 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 34 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 36 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 38 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 39 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 40 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 41 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 86 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 87 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 88 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 89 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 90 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 91 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 92 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 93 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 94 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 95 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 96 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 97 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 98 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 99 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 100 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 101 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 102 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 103 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 104 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 105 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 106 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 107 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 108 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 109 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 110 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 111 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 112 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 113 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 114 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 126 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 127 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 128 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 129 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 130 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 131 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 132 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 133 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 134 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 135 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 137 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 138 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 139 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 140 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 141 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 145 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.11 |
| Nodule | 0 |
| Rhizoplane | 7.39 |
| Rhizosphere | 85.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10018274 | 3300002459 | Unclassified | 1450 |
| 2 | rootL2_10331247 | 3300003322 | Bacteria | 1383 |
| 3 | Ga0065715_10572678 | 3300005293 | Bacteria | 726 |
| 4 | Ga0070658_10325932 | 3300005327 | Bacteria | 1312 |
| 5 | Ga0070658_10525451 | 3300005327 | Bacteria | 1023 |
| 6 | Ga0070658_10550932 | 3300005327 | Bacteria | 998 |
| 7 | Ga0070676_10005204 | 3300005328 | Bacteria | 6913 |
| 8 | Ga0070683_100000219 | 3300005329 | Bacteria | 39225 |
| 9 | Ga0070670_100021126 | 3300005331 | Bacteria | 5599 |
| 10 | Ga0070670_100031172 | 3300005331 | Bacteria | 4592 |
| 11 | Ga0070666_10628674 | 3300005335 | Bacteria | 784 |
| 12 | Ga0070682_100249298 | 3300005337 | Unclassified | 1279 |
| 13 | Ga0070682_100292255 | 3300005337 | Bacteria | 1192 |
| 14 | Ga0070660_100329166 | 3300005339 | Unclassified | 1256 |
| 15 | Ga0070689_100327353 | 3300005340 | Bacteria | 1281 |
| 16 | Ga0070661_100019594 | 3300005344 | Bacteria | 4822 |
| 17 | Ga0070671_100079935 | 3300005355 | Bacteria | 2733 |
| 18 | Ga0070674_100226901 | 3300005356 | Bacteria | 1456 |
| 19 | Ga0070659_100045846 | 3300005366 | Bacteria | 3426 |
| 20 | Ga0070714_100128097 | 3300005435 | Bacteria | 2266 |
| 21 | Ga0070713_100667929 | 3300005436 | Bacteria | 990 |
| 22 | Ga0070663_100019435 | 3300005455 | Bacteria | 4478 |
| 23 | Ga0070662_100059335 | 3300005457 | Bacteria | 2787 |
| 24 | Ga0070681_10179599 | 3300005458 | Bacteria | 2038 |
| 25 | Ga0070706_100934133 | 3300005467 | Bacteria | 801 |
| 26 | Ga0070699_100173144 | 3300005518 | Bacteria | 1913 |
| 27 | Ga0070684_100004177 | 3300005535 | Bacteria | 10942 |
| 28 | Ga0070665_100102592 | 3300005548 | Unclassified | 2864 |
| 29 | Ga0070665_100312528 | 3300005548 | Bacteria | 1575 |
| 30 | Ga0068855_100077534 | 3300005563 | Bacteria | 3856 |
| 31 | Ga0070664_100005403 | 3300005564 | Bacteria | 10256 |
| 32 | Ga0070664_100079170 | 3300005564 | Bacteria | 2828 |
| 33 | Ga0068856_100039160 | 3300005614 | Bacteria | 4654 |
| 34 | Ga0068864_100095356 | 3300005618 | Bacteria | 2631 |
| 35 | Ga0068864_100857833 | 3300005618 | Bacteria | 895 |
| 36 | Ga0068866_10107696 | 3300005718 | Unclassified | 1549 |
| 37 | Ga0068861_100494710 | 3300005719 | Bacteria | 1104 |
| 38 | Ga0068858_100535274 | 3300005842 | Bacteria | 1134 |
| 39 | Ga0075368_10039697 | 3300006042 | Bacteria | 1846 |
| 40 | Ga0075363_100209191 | 3300006048 | Bacteria | 1116 |
| 41 | Ga0075363_100327312 | 3300006048 | Bacteria | 892 |
| 42 | Ga0070715_10251880 | 3300006163 | Bacteria | 923 |
| 43 | Ga0075366_10002470 | 3300006195 | Bacteria | 9469 |
| 44 | Ga0097621_100036705 | 3300006237 | Bacteria | 3922 |
| 45 | Ga0075370_10127804 | 3300006353 | Bacteria | 1482 |
| 46 | Ga0068871_101103755 | 3300006358 | Bacteria | 742 |
| 47 | Ga0075428_100265801 | 3300006844 | Bacteria | 1846 |
| 48 | Ga0075428_100340766 | 3300006844 | Bacteria | 1610 |
| 49 | Ga0075431_100153227 | 3300006847 | Bacteria | 2373 |
| 50 | Ga0075434_100517820 | 3300006871 | Bacteria | 1213 |
| 51 | Ga0105240_10001577 | 3300009093 | Bacteria | 38667 |
| 52 | Ga0111539_10000364 | 3300009094 | Bacteria | 55762 |
| 53 | Ga0105242_10272892 | 3300009176 | Bacteria | 1533 |
| 54 | Ga0105242_10681147 | 3300009176 | Bacteria | 1004 |
| 55 | Ga0105248_10064726 | 3300009177 | Bacteria | 4104 |
| 56 | Ga0105248_10128188 | 3300009177 | Bacteria | 2862 |
| 57 | Ga0105237_10021283 | 3300009545 | Bacteria | 6669 |
| 58 | Ga0105238_11120682 | 3300009551 | Bacteria | 810 |
| 59 | Ga0105239_10305174 | 3300010375 | Bacteria | 1793 |
| 60 | Ga0105239_11262856 | 3300010375 | Bacteria | 852 |
| 61 | Ga0157370_10038103 | 3300013104 | Bacteria | 4653 |
| 62 | Ga0157369_10008465 | 3300013105 | Bacteria | 11798 |
| 63 | Ga0157374_10183090 | 3300013296 | Bacteria | 2047 |
| 64 | Ga0163162_10967700 | 3300013306 | Bacteria | 962 |
| 65 | Ga0157372_10115343 | 3300013307 | Bacteria | 3080 |
| 66 | Ga0157375_10091270 | 3300013308 | Bacteria | 3107 |
| 67 | Ga0163163_10000042 | 3300014325 | Bacteria | 138794 |
| 68 | Ga0163163_10064148 | 3300014325 | Bacteria | 3645 |
| 69 | Ga0157380_10259649 | 3300014326 | Bacteria | 1577 |
| 70 | Ga0157380_10824640 | 3300014326 | Bacteria | 947 |
| 71 | Ga0157376_10070654 | 3300014969 | Bacteria | 2964 |
| 72 | Ga0157376_10508435 | 3300014969 | Bacteria | 1185 |
| 73 | Ga0207642_10061869 | 3300025899 | Bacteria | 1743 |
| 74 | Ga0207645_10026369 | 3300025907 | Unclassified | 3756 |
| 75 | Ga0207705_10259314 | 3300025909 | Bacteria | 1327 |
| 76 | Ga0207707_10172517 | 3300025912 | Bacteria | 1890 |
| 77 | Ga0207695_10002352 | 3300025913 | Bacteria | 28101 |
| 78 | Ga0207671_10257203 | 3300025914 | Unclassified | 1373 |
| 79 | Ga0207649_10006738 | 3300025920 | Bacteria | 6240 |
| 80 | Ga0207650_10034208 | 3300025925 | Bacteria | 3685 |
| 81 | Ga0207650_10075745 | 3300025925 | Bacteria | 2540 |
| 82 | Ga0207700_10557970 | 3300025928 | Bacteria | 1017 |
| 83 | Ga0207664_10118730 | 3300025929 | Bacteria | 2210 |
| 84 | Ga0207644_10139370 | 3300025931 | Bacteria | 1866 |
| 85 | Ga0207690_10025257 | 3300025932 | Bacteria | 3728 |
| 86 | Ga0207706_10082868 | 3300025933 | Bacteria | 2819 |
| 87 | Ga0207686_10126732 | 3300025934 | Bacteria | 1746 |
| 88 | Ga0207711_10074724 | 3300025941 | Bacteria | 2948 |
| 89 | Ga0207661_10005019 | 3300025944 | Bacteria | 9278 |
| 90 | Ga0207679_10015458 | 3300025945 | Bacteria | 5044 |
| 91 | Ga0207679_10080000 | 3300025945 | Bacteria | 2494 |
| 92 | Ga0207667_10061796 | 3300025949 | Bacteria | 3918 |
| 93 | Ga0207703_10497884 | 3300026035 | Bacteria | 1143 |
| 94 | Ga0207639_10322160 | 3300026041 | Bacteria | 1373 |
| 95 | Ga0207678_10038069 | 3300026067 | Bacteria | 4181 |
| 96 | Ga0207648_10064627 | 3300026089 | Bacteria | 3189 |
| 97 | Ga0207676_10090997 | 3300026095 | Bacteria | 2505 |
| 98 | Ga0207676_10588332 | 3300026095 | Bacteria | 1068 |
| 99 | Ga0207674_10135888 | 3300026116 | Bacteria | 2421 |
| 100 | Ga0207675_100121400 | 3300026118 | Bacteria | 2473 |
| 101 | Ga0207698_10117140 | 3300026142 | Bacteria | 2247 |
| 102 | Ga0209813_10008263 | 3300027866 | Bacteria | 2623 |
| 103 | Ga0265325_10047984 | 3300031241 | Unclassified | 2209 |
| 104 | Ga0265316_10005096 | 3300031344 | Bacteria | 12873 |
| 105 | Ga0265316_10007141 | 3300031344 | Bacteria | 10560 |
| 106 | Ga0265316_10322270 | 3300031344 | Bacteria | 1122 |
| 107 | Ga0307408_100008001 | 3300031548 | Bacteria | 6989 |
| 108 | Ga0307408_100233307 | 3300031548 | Bacteria | 1508 |
| 109 | Ga0265342_10034372 | 3300031712 | Bacteria | 3110 |
| 110 | Ga0307413_10397214 | 3300031824 | Bacteria | 1079 |
| 111 | Ga0307410_10055916 | 3300031852 | Bacteria | 2681 |
| 112 | Ga0307407_10037094 | 3300031903 | Bacteria | 2691 |
| 113 | Ga0307416_100212053 | 3300032002 | Bacteria | 1848 |
| 114 | Ga0307411_10026713 | 3300032005 | Bacteria | 3480 |
| 115 | Ga0373934_0004828 | 3300035086 | Bacteria | 4987 |
| 116 | Ga0373956_0004812 | 3300035119 | Bacteria | 5399 |
| 117 | Ga0373957_0005244 | 3300035120 | Bacteria | 4011 |
| 118 | Ga0373946_0149418 | 3300035171 | Bacteria | 1089 |
| 119 | Ga0373955_0002132 | 3300035172 | Bacteria | 8546 |
| 120 | Ga0373927_0231849 | 3300035695 | Bacteria | 1213 |
| 121 | Ga0373933_0017187 | 3300035724 | Bacteria | 4055 |
| 122 | Ga0373947_0139311 | 3300035725 | Bacteria | 1555 |
| 123 | Ga0373937_0032913 | 3300036401 | Bacteria | 4703 |
| 124 | Ga0373937_0526798 | 3300036401 | Bacteria | 1123 |
| 125 | Ga0373937_0769355 | 3300036401 | Bacteria | 910 |
| 126 | Ga0436364_0047123 | 3300037853 | Unclassified | 3389 |
| 127 | Ga0395901_1209835 | 3300038443 | Unclassified | 721 |
| 128 | Ga0395901_1314210 | 3300038443 | Bacteria | 684 |
| 129 | Ga0436365_0448621 | 3300039437 | Unclassified | 1614 |
| 130 | Ga0439445_0017828 | 3300042004 | Bacteria | 1758 |
| 131 | Ga0439435_0001782 | 3300042436 | Bacteria | 4102 |
| 132 | Ga0453683_0117060 | 3300044673 | Bacteria | 1677 |
| 133 | Ga0466963_0496252 | 3300044694 | Unclassified | 862 |
| 134 | Ga0466971_0180648 | 3300044719 | Bacteria | 992 |
| 135 | Ga0466959_0187350 | 3300045049 | Bacteria | 1445 |
| 136 | Ga0451576_0061210 | 3300045051 | Bacteria | 3926 |
| 137 | Ga0451576_0098980 | 3300045051 | Bacteria | 3033 |
| 138 | Ga0466967_0155268 | 3300045976 | Bacteria | 2143 |
| 139 | Ga0495651_0084127 | 3300046462 | Bacteria | 2398 |
| 140 | Ga0495580_0028484 | 3300046472 | Bacteria | 4060 |
| 141 | Ga0495582_0363237 | 3300046473 | Bacteria | 834 |
| 142 | Ga0495664_0242151 | 3300046477 | Bacteria | 1091 |
| 143 | Ga0495628_0604713 | 3300046516 | Bacteria | 783 |
| 144 | Ga0495621_0223671 | 3300046539 | Bacteria | 762 |
| 145 | Ga0495634_0227986 | 3300046642 | Bacteria | 1147 |
| 146 | Ga0495635_0428085 | 3300046663 | Bacteria | 877 |
| 147 | Ga0495658_0033261 | 3300046683 | Bacteria | 2822 |
| 148 | Ga0495658_0146935 | 3300046683 | Bacteria | 1445 |
| 149 | Ga0495658_0305372 | 3300046683 | Bacteria | 1007 |
| 150 | Ga0495676_0029927 | 3300047321 | Bacteria | 4629 |
| 151 | Ga0495684_0242696 | 3300047471 | Bacteria | 1313 |
| 152 | Ga0496104_0010197 | 3300048907 | Bacteria | 8388 |
| 153 | Ga0496104_0012179 | 3300048907 | Bacteria | 7725 |
| 154 | Ga0496105_0010021 | 3300048908 | Bacteria | 7436 |
| 155 | Ga0496105_0047755 | 3300048908 | Bacteria | 3533 |
| 156 | Ga0496106_0228481 | 3300048909 | Bacteria | 1485 |
| 157 | Ga0496108_0001066 | 3300048911 | Bacteria | 21388 |
| 158 | Ga0496109_0000525 | 3300048912 | Bacteria | 32426 |
| 159 | Ga0496110_0001750 | 3300048913 | Bacteria | 16012 |
| 160 | Ga0496110_0182965 | 3300048913 | Bacteria | 1903 |
| 161 | Ga0496111_0000267 | 3300048914 | Bacteria | 25489 |
| 162 | Ga0496112_0004758 | 3300048915 | Bacteria | 11577 |
| 163 | Ga0496114_0028776 | 3300048917 | Bacteria | 4562 |
| 164 | Ga0496115_0132663 | 3300048918 | Bacteria | 2053 |
| 165 | Ga0501041_0791361 | 3300049577 | Bacteria | 608 |
| 166 | nmdc:mga06z11_456908_c1 | 3300050494 | Bacteria | 772 |
| 167 | nmdc:mga04h51_19624_c1 | 3300050495 | Bacteria | 2007 |
| 168 | nmdc:mga07m45_370642_c1 | 3300050496 | Bacteria | 832 |
| 169 | nmdc:mga0qj67_463295_c1 | 3300050509 | Bacteria | 1020 |
| 170 | nmdc:mga06r32_807644_c1 | 3300050510 | Unclassified | 898 |
| 171 | Ga0495601_0009640 | 3300053077 | Bacteria | 5716 |
| 172 | Ga0495595_0003230 | 3300053084 | Bacteria | 6474 |
| 173 | Ga0495619_0062757 | 3300053085 | Bacteria | 2474 |
| 174 | Ga0495619_0293852 | 3300053085 | Bacteria | 1126 |
| 175 | Ga0590071_028577 | 3300059421 | Bacteria | 1325 |
| 176 | Ga0590077_027356 | 3300059426 | Bacteria | 1235 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005436 | Ga0070713_100667929 | Ga0070713_1006679291 | 172 |
| 2 | 3300025928 | Ga0207700_10557970 | Ga0207700_105579702 | 172 |
| 3 | 3300046516 | Ga0495628_0604713 | Ga0495628_0604713_242_772 | 175 |
| 4 | 3300049577 | Ga0501041_0791361 | Ga0501041_0791361_16_552 | 178 |
| 5 | 3300026035 | Ga0207703_10497884 | Ga0207703_104978842 | 179 |
| 6 | 3300045051 | Ga0451576_0098980 | Ga0451576_0098980_1940_2509 | 179 |
| 7 | 3300005618 | Ga0068864_100857833 | Ga0068864_1008578331 | 187 |
| 8 | 3300005842 | Ga0068858_100535274 | Ga0068858_1005352742 | 187 |
| 9 | 3300006358 | Ga0068871_101103755 | Ga0068871_1011037552 | 187 |
| 10 | 3300014325 | Ga0163163_10000042 | Ga0163163_100000428 | 187 |
| 11 | 3300048913 | Ga0496110_0182965 | Ga0496110_0182965_517_1086 | 187 |
| 12 | 3300005293 | Ga0065715_10572678 | Ga0065715_105726781 | 188 |
| 13 | 3300005329 | Ga0070683_100000219 | Ga0070683_1000002196 | 188 |
| 14 | 3300005331 | Ga0070670_100021126 | Ga0070670_1000211265 | 188 |
| 15 | 3300005335 | Ga0070666_10628674 | Ga0070666_106286741 | 188 |
| 16 | 3300005340 | Ga0070689_100327353 | Ga0070689_1003273531 | 188 |
| 17 | 3300005344 | Ga0070661_100019594 | Ga0070661_1000195943 | 188 |
| 18 | 3300005355 | Ga0070671_100079935 | Ga0070671_1000799352 | 188 |
| 19 | 3300005455 | Ga0070663_100019435 | Ga0070663_1000194354 | 188 |
| 20 | 3300005457 | Ga0070662_100059335 | Ga0070662_1000593352 | 188 |
| 21 | 3300005535 | Ga0070684_100004177 | Ga0070684_1000041776 | 188 |
| 22 | 3300005564 | Ga0070664_100005403 | Ga0070664_1000054035 | 188 |
| 23 | 3300005618 | Ga0068864_100095356 | Ga0068864_1000953562 | 188 |
| 24 | 3300009177 | Ga0105248_10128188 | Ga0105248_101281883 | 188 |
| 25 | 3300010375 | Ga0105239_11262856 | Ga0105239_112628562 | 188 |
| 26 | 3300013296 | Ga0157374_10183090 | Ga0157374_101830902 | 188 |
| 27 | 3300014325 | Ga0163163_10064148 | Ga0163163_100641484 | 188 |
| 28 | 3300025920 | Ga0207649_10006738 | Ga0207649_100067383 | 188 |
| 29 | 3300025925 | Ga0207650_10075745 | Ga0207650_100757452 | 188 |
| 30 | 3300025931 | Ga0207644_10139370 | Ga0207644_101393702 | 188 |
| 31 | 3300025933 | Ga0207706_10082868 | Ga0207706_100828682 | 188 |
| 32 | 3300025941 | Ga0207711_10074724 | Ga0207711_100747242 | 188 |
| 33 | 3300025944 | Ga0207661_10005019 | Ga0207661_100050198 | 188 |
| 34 | 3300026067 | Ga0207678_10038069 | Ga0207678_100380692 | 188 |
| 35 | 3300026095 | Ga0207676_10090997 | Ga0207676_100909972 | 188 |
| 36 | 3300048907 | Ga0496104_0012179 | Ga0496104_0012179_3065_3658 | 188 |
| 37 | 3300048908 | Ga0496105_0010021 | Ga0496105_0010021_2221_2814 | 188 |
| 38 | 3300048909 | Ga0496106_0228481 | Ga0496106_0228481_577_1170 | 188 |
| 39 | 3300048911 | Ga0496108_0001066 | Ga0496108_0001066_3371_3964 | 188 |
| 40 | 3300048912 | Ga0496109_0000525 | Ga0496109_0000525_3824_4417 | 188 |
| 41 | 3300048913 | Ga0496110_0001750 | Ga0496110_0001750_477_1070 | 188 |
| 42 | 3300048914 | Ga0496111_0000267 | Ga0496111_0000267_4373_4966 | 188 |
| 43 | 3300048915 | Ga0496112_0004758 | Ga0496112_0004758_7129_7722 | 188 |
| 44 | 3300059421 | Ga0590071_028577 | Ga0590071_028577_273_902 | 188 |
| 45 | 3300005366 | Ga0070659_100045846 | Ga0070659_1000458463 | 192 |
| 46 | 3300025932 | Ga0207690_10025257 | Ga0207690_100252572 | 192 |
| 47 | 3300046663 | Ga0495635_0428085 | Ga0495635_0428085_171_794 | 192 |
| 48 | 3300050509 | nmdc:mga0qj67_463295_c1 | nmdc:mga0qj67_463295_c1_36_638 | 192 |
| 49 | 3300003322 | rootL2_10331247 | rootL2_103312472 | 193 |
| 50 | 3300053085 | Ga0495619_0293852 | Ga0495619_0293852_472_1095 | 194 |
| 51 | 3300059426 | Ga0590077_027356 | Ga0590077_027356_287_916 | 194 |
| 52 | 3300005327 | Ga0070658_10325932 | Ga0070658_103259322 | 195 |
| 53 | 3300005328 | Ga0070676_10005204 | Ga0070676_100052042 | 195 |
| 54 | 3300005337 | Ga0070682_100249298 | Ga0070682_1002492982 | 195 |
| 55 | 3300005337 | Ga0070682_100292255 | Ga0070682_1002922552 | 195 |
| 56 | 3300005548 | Ga0070665_100102592 | Ga0070665_1001025922 | 195 |
| 57 | 3300005548 | Ga0070665_100312528 | Ga0070665_1003125282 | 195 |
| 58 | 3300005564 | Ga0070664_100079170 | Ga0070664_1000791703 | 195 |
| 59 | 3300005718 | Ga0068866_10107696 | Ga0068866_101076962 | 195 |
| 60 | 3300009176 | Ga0105242_10681147 | Ga0105242_106811472 | 195 |
| 61 | 3300009551 | Ga0105238_11120682 | Ga0105238_111206821 | 195 |
| 62 | 3300010375 | Ga0105239_10305174 | Ga0105239_103051742 | 195 |
| 63 | 3300013306 | Ga0163162_10967700 | Ga0163162_109677002 | 195 |
| 64 | 3300025899 | Ga0207642_10061869 | Ga0207642_100618693 | 195 |
| 65 | 3300025907 | Ga0207645_10026369 | Ga0207645_100263694 | 195 |
| 66 | 3300025934 | Ga0207686_10126732 | Ga0207686_101267321 | 195 |
| 67 | 3300025945 | Ga0207679_10015458 | Ga0207679_100154584 | 195 |
| 68 | 3300025945 | Ga0207679_10080000 | Ga0207679_100800003 | 195 |
| 69 | 3300026089 | Ga0207648_10064627 | Ga0207648_100646274 | 195 |
| 70 | 3300026116 | Ga0207674_10135888 | Ga0207674_101358883 | 195 |
| 71 | 3300042004 | Ga0439445_0017828 | Ga0439445_0017828_440_1075 | 195 |
| 72 | 3300044673 | Ga0453683_0117060 | Ga0453683_0117060_133_753 | 195 |
| 73 | 3300045051 | Ga0451576_0061210 | Ga0451576_0061210_1419_2039 | 195 |
| 74 | 3300031548 | Ga0307408_100233307 | Ga0307408_1002333071 | 196 |
| 75 | 3300031824 | Ga0307413_10397214 | Ga0307413_103972142 | 196 |
| 76 | 3300031852 | Ga0307410_10055916 | Ga0307410_100559164 | 196 |
| 77 | 3300032005 | Ga0307411_10026713 | Ga0307411_100267133 | 196 |
| 78 | 3300042436 | Ga0439435_0001782 | Ga0439435_0001782_2717_3385 | 196 |
| 79 | 3300046477 | Ga0495664_0242151 | Ga0495664_0242151_43_633 | 196 |
| 80 | 3300046539 | Ga0495621_0223671 | Ga0495621_0223671_143_736 | 196 |
| 81 | 3300005327 | Ga0070658_10525451 | Ga0070658_105254511 | 199 |
| 82 | 3300005327 | Ga0070658_10550932 | Ga0070658_105509321 | 199 |
| 83 | 3300005339 | Ga0070660_100329166 | Ga0070660_1003291661 | 199 |
| 84 | 3300005435 | Ga0070714_100128097 | Ga0070714_1001280972 | 199 |
| 85 | 3300005458 | Ga0070681_10179599 | Ga0070681_101795992 | 199 |
| 86 | 3300005563 | Ga0068855_100077534 | Ga0068855_1000775344 | 199 |
| 87 | 3300005614 | Ga0068856_100039160 | Ga0068856_1000391606 | 199 |
| 88 | 3300009093 | Ga0105240_10001577 | Ga0105240_1000157711 | 199 |
| 89 | 3300009545 | Ga0105237_10021283 | Ga0105237_100212835 | 199 |
| 90 | 3300013104 | Ga0157370_10038103 | Ga0157370_100381034 | 199 |
| 91 | 3300013105 | Ga0157369_10008465 | Ga0157369_1000846512 | 199 |
| 92 | 3300013307 | Ga0157372_10115343 | Ga0157372_101153432 | 199 |
| 93 | 3300025909 | Ga0207705_10259314 | Ga0207705_102593142 | 199 |
| 94 | 3300025912 | Ga0207707_10172517 | Ga0207707_101725172 | 199 |
| 95 | 3300025913 | Ga0207695_10002352 | Ga0207695_1000235220 | 199 |
| 96 | 3300025914 | Ga0207671_10257203 | Ga0207671_102572032 | 199 |
| 97 | 3300025929 | Ga0207664_10118730 | Ga0207664_101187302 | 199 |
| 98 | 3300025949 | Ga0207667_10061796 | Ga0207667_100617962 | 199 |
| 99 | 3300026142 | Ga0207698_10117140 | Ga0207698_101171402 | 199 |
| 100 | 3300031241 | Ga0265325_10047984 | Ga0265325_100479842 | 199 |
| 101 | 3300031344 | Ga0265316_10007141 | Ga0265316_100071419 | 199 |
| 102 | 3300031344 | Ga0265316_10322270 | Ga0265316_103222702 | 199 |
| 103 | 3300031712 | Ga0265342_10034372 | Ga0265342_100343723 | 199 |
| 104 | 3300035695 | Ga0373927_0231849 | Ga0373927_0231849_105_704 | 199 |
| 105 | 3300037853 | Ga0436364_0047123 | Ga0436364_0047123_242_841 | 199 |
| 106 | 3300038443 | Ga0395901_1209835 | Ga0395901_1209835_31_636 | 199 |
| 107 | 3300039437 | Ga0436365_0448621 | Ga0436365_0448621_773_1384 | 199 |
| 108 | 3300044694 | Ga0466963_0496252 | Ga0466963_0496252_61_666 | 199 |
| 109 | 3300044719 | Ga0466971_0180648 | Ga0466971_0180648_76_681 | 199 |
| 110 | 3300045049 | Ga0466959_0187350 | Ga0466959_0187350_151_756 | 199 |
| 111 | 3300045976 | Ga0466967_0155268 | Ga0466967_0155268_321_926 | 199 |
| 112 | 3300046472 | Ga0495580_0028484 | Ga0495580_0028484_58_657 | 199 |
| 113 | 3300048907 | Ga0496104_0010197 | Ga0496104_0010197_7592_8332 | 199 |
| 114 | 3300048908 | Ga0496105_0047755 | Ga0496105_0047755_217_933 | 199 |
| 115 | 3300048917 | Ga0496114_0028776 | Ga0496114_0028776_1336_2076 | 199 |
| 116 | 3300048918 | Ga0496115_0132663 | Ga0496115_0132663_216_956 | 199 |
| 117 | 3300009177 | Ga0105248_10064726 | Ga0105248_100647263 | 200 |
| 118 | 3300031344 | Ga0265316_10005096 | Ga0265316_100050967 | 200 |
| 119 | 3300035171 | Ga0373946_0149418 | Ga0373946_0149418_92_694 | 200 |
| 120 | 3300035725 | Ga0373947_0139311 | Ga0373947_0139311_667_1269 | 200 |
| 121 | 3300036401 | Ga0373937_0769355 | Ga0373937_0769355_100_702 | 200 |
| 122 | 3300046683 | Ga0495658_0146935 | Ga0495658_0146935_230_832 | 200 |
| 123 | 3300047471 | Ga0495684_0242696 | Ga0495684_0242696_553_1155 | 200 |
| 124 | 3300053077 | Ga0495601_0009640 | Ga0495601_0009640_2571_3173 | 200 |
| 125 | 3300053084 | Ga0495595_0003230 | Ga0495595_0003230_4593_5195 | 200 |
| 126 | 3300006237 | Ga0097621_100036705 | Ga0097621_1000367053 | 202 |
| 127 | 3300006844 | Ga0075428_100265801 | Ga0075428_1002658012 | 202 |
| 128 | 3300006847 | Ga0075431_100153227 | Ga0075431_1001532272 | 202 |
| 129 | 3300009176 | Ga0105242_10272892 | Ga0105242_102728922 | 202 |
| 130 | 3300013308 | Ga0157375_10091270 | Ga0157375_100912703 | 202 |
| 131 | 3300014969 | Ga0157376_10070654 | Ga0157376_100706542 | 202 |
| 132 | 3300026041 | Ga0207639_10322160 | Ga0207639_103221602 | 202 |
| 133 | 3300026095 | Ga0207676_10588332 | Ga0207676_105883321 | 202 |
| 134 | 3300031548 | Ga0307408_100008001 | Ga0307408_1000080012 | 202 |
| 135 | 3300035086 | Ga0373934_0004828 | Ga0373934_0004828_1855_2484 | 202 |
| 136 | 3300035119 | Ga0373956_0004812 | Ga0373956_0004812_3801_4430 | 202 |
| 137 | 3300035120 | Ga0373957_0005244 | Ga0373957_0005244_1129_1758 | 202 |
| 138 | 3300035172 | Ga0373955_0002132 | Ga0373955_0002132_2787_3416 | 202 |
| 139 | 3300035724 | Ga0373933_0017187 | Ga0373933_0017187_3390_4019 | 202 |
| 140 | 3300036401 | Ga0373937_0032913 | Ga0373937_0032913_3677_4306 | 202 |
| 141 | 3300036401 | Ga0373937_0526798 | Ga0373937_0526798_416_1024 | 202 |
| 142 | 3300046462 | Ga0495651_0084127 | Ga0495651_0084127_625_1257 | 202 |
| 143 | 3300050494 | nmdc:mga06z11_456908_c1 | nmdc:mga06z11_456908_c1_89_715 | 202 |
| 144 | 3300050510 | nmdc:mga06r32_807644_c1 | nmdc:mga06r32_807644_c1_113_739 | 202 |
| 145 | 3300005467 | Ga0070706_100934133 | Ga0070706_1009341331 | 203 |
| 146 | 3300005719 | Ga0068861_100494710 | Ga0068861_1004947101 | 203 |
| 147 | 3300006042 | Ga0075368_10039697 | Ga0075368_100396972 | 203 |
| 148 | 3300006048 | Ga0075363_100209191 | Ga0075363_1002091911 | 203 |
| 149 | 3300006048 | Ga0075363_100327312 | Ga0075363_1003273122 | 203 |
| 150 | 3300006163 | Ga0070715_10251880 | Ga0070715_102518801 | 203 |
| 151 | 3300006195 | Ga0075366_10002470 | Ga0075366_100024705 | 203 |
| 152 | 3300006353 | Ga0075370_10127804 | Ga0075370_101278042 | 203 |
| 153 | 3300006871 | Ga0075434_100517820 | Ga0075434_1005178201 | 203 |
| 154 | 3300009094 | Ga0111539_10000364 | Ga0111539_100003645 | 203 |
| 155 | 3300014326 | Ga0157380_10824640 | Ga0157380_108246402 | 203 |
| 156 | 3300014969 | Ga0157376_10508435 | Ga0157376_105084352 | 203 |
| 157 | 3300027866 | Ga0209813_10008263 | Ga0209813_100082633 | 203 |
| 158 | 3300031903 | Ga0307407_10037094 | Ga0307407_100370942 | 203 |
| 159 | 3300032002 | Ga0307416_100212053 | Ga0307416_1002120531 | 203 |
| 160 | 3300046473 | Ga0495582_0363237 | Ga0495582_0363237_65_721 | 203 |
| 161 | 3300046642 | Ga0495634_0227986 | Ga0495634_0227986_519_1130 | 203 |
| 162 | 3300046683 | Ga0495658_0033261 | Ga0495658_0033261_315_971 | 203 |
| 163 | 3300046683 | Ga0495658_0305372 | Ga0495658_0305372_118_729 | 203 |
| 164 | 3300047321 | Ga0495676_0029927 | Ga0495676_0029927_2984_3640 | 203 |
| 165 | 3300050495 | nmdc:mga04h51_19624_c1 | nmdc:mga04h51_19624_c1_144_779 | 203 |
| 166 | 3300050496 | nmdc:mga07m45_370642_c1 | nmdc:mga07m45_370642_c1_181_816 | 203 |
| 167 | 3300053085 | Ga0495619_0062757 | Ga0495619_0062757_736_1347 | 203 |
| 168 | 3300002459 | JGI24751J29686_10018274 | JGI24751J29686_100182742 | 204 |
| 169 | 3300005331 | Ga0070670_100031172 | Ga0070670_1000311724 | 204 |
| 170 | 3300005356 | Ga0070674_100226901 | Ga0070674_1002269012 | 204 |
| 171 | 3300005518 | Ga0070699_100173144 | Ga0070699_1001731442 | 204 |
| 172 | 3300006844 | Ga0075428_100340766 | Ga0075428_1003407662 | 204 |
| 173 | 3300014326 | Ga0157380_10259649 | Ga0157380_102596492 | 204 |
| 174 | 3300025925 | Ga0207650_10034208 | Ga0207650_100342083 | 204 |
| 175 | 3300026118 | Ga0207675_100121400 | Ga0207675_1001214003 | 204 |
| 176 | 3300038443 | Ga0395901_1314210 | Ga0395901_1314210_18_674 | 204 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ywr-assembly1.cif.gz_A | crystal structure of gar transformylase from aquifex aeolicus | 0.9648 | 5 | 201 |
| 1c2t-assembly1.cif.gz_A | new insights into inhibitor design from the crystal structure and nmr studies of e. coli gar transformylase in complex with beta-gar and 10-formyl-5,8,10-trideazafolic acid. | 0.952 | 6 | 202 |
| 3auf-assembly1.cif.gz_A-2 | crystal structure of glycinamide ribonucleotide transformylase 1 from symbiobacterium toebii | 0.9511 | 1 | 203 |
| 3tqr-assembly1.cif.gz_A | structure of the phosphoribosylglycinamide formyltransferase (purn) in complex with ches from coxiella burnetii | 0.9509 | 4 | 202 |
| 3auf-assembly1.cif.gz_A-2 | crystal structure of glycinamide ribonucleotide transformylase 1 from symbiobacterium toebii | 0.9466 | 1 | 203 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZI7_1_188_3.40.50.170 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9667 | 5 | 189 | 3.40.50.170 |
| 2ywrA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9626 | 6 | 201 | 3.40.50.170 |
| 3aufA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9511 | 1 | 203 | 3.40.50.170 |
| af_Q2FZI7_1_188_3.40.50.170 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9467 | 5 | 189 | 3.40.50.170 |
| 3aufA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9466 | 1 | 203 | 3.40.50.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8G8Z8-F1-model_v4 | Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) | 0.9765 | 28 | 201 |
GO:0004644
GO:0005829 GO:0006189 |
| AF-A0A7V9CNL6-F1-model_v4 | phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) | 0.9736 | 1 | 93 |
GO:0004644
GO:0005737 GO:0006189 |
| AF-A0A550JKQ1-F1-model_v4 | Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) | 0.9707 | 1 | 201 |
GO:0004644
GO:0005829 GO:0006189 |
| AF-A0A350CZ61-F1-model_v4 | Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) | 0.9667 | 6 | 179 |
GO:0004644
GO:0005829 GO:0006189 |
| AF-A0A1V1RGY4-F1-model_v4 | Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) | 0.9644 | 1 | 203 |
GO:0004644
GO:0005829 GO:0006189 GO:0006730 GO:0008864 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar