F268163

General Info

Members Datasets Scaffolds Average Seq Length
176 110 352 278

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10001660|Ga0105240_1000166022
Length 304
Sequence MPAIFPNFYGRKEASGKLNLMAFRYAMCNEAFERRPFGEVCQVLKRLGYQGIEIAPFTLAEDPLLISAAQRKEYRGIMAAEGIDFAGLHWLLVTPKQIHVSTPDKALREQSWQYVRNLIDLCADLAGPGATDSVMVFGSPKQRSTTGGITAAEATRNFIEGLASIAPHAETRGVTILMEALPRSQSDVVNTLADAAGVVRQIASPAVKTMFDSHNSEDETAPHHQLIEKYFDIVRHVHVNEMDGRHPGTGDYDFISIFRTLQSLNYQHWVSLEAFDFKPGGERIAAETIQYLKKQEEIALENLQ

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
64 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
65 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
66 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
67 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
68 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
69 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
70 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
71 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
75 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
76 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
77 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
78 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
79 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
80 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
81 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
82 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
83 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
84 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
85 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
86 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
87 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
88 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
89 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
90 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
91 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
92 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
93 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
100 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
101 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
102 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
103 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
104 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
106 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
107 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
108 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
109 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
110 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.73
Metatranscriptomes 1.14
Isolates 1.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.57
Rhizosphere 98.86
Stem 0
Stem Tuber 0
Unclassified 9.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10001660 3300009093 Bacteria 37767
2 Ga0070658_10096954 3300005327 Bacteria 2435
3 Ga0070683_100000006 3300005329 Bacteria 361071
4 Ga0070683_100028231 3300005329 Bacteria 5070
5 Ga0070670_100247042 3300005331 Bacteria 1554
6 Ga0070680_100000906 3300005336 Bacteria 20990
7 Ga0070660_100130592 3300005339 Bacteria 2010
8 Ga0070688_100276304 3300005365 Bacteria 1205
9 Ga0070713_100223444 3300005436 Bacteria 1709
10 Ga0070713_100256415 3300005436 Bacteria 1597
11 Ga0070681_10036327 3300005458 Bacteria 4947
12 Ga0070681_10071210 3300005458 Bacteria 3441
13 Ga0070681_10128698 3300005458 Bacteria 2464
14 Ga0070681_10252450 3300005458 Bacteria 1676
15 Ga0070685_10069019 3300005466 Bacteria 2089
16 Ga0070706_100129933 3300005467 Bacteria 2351
17 Ga0070699_100186687 3300005518 Bacteria 1841
18 Ga0070699_100524230 3300005518 Bacteria 1077
19 Ga0070684_100000050 3300005535 Bacteria 78974
20 Ga0070697_100451984 3300005536 Bacteria 1119
21 Ga0070672_100486596 3300005543 Bacteria 1066
22 Ga0070696_100113736 3300005546 Bacteria 1951
23 Ga0070665_100308817 3300005548 Bacteria 1585
24 Ga0068855_100007695 3300005563 Bacteria 13014
25 Ga0068855_100031200 3300005563 Bacteria 6366
26 Ga0068855_100200474 3300005563 Bacteria 2246
27 Ga0068856_100038992 3300005614 Bacteria 4665
28 Ga0068852_100007159 3300005616 Bacteria 8131
29 Ga0068859_100066474 3300005617 Bacteria 3640
30 Ga0068859_100376015 3300005617 Bacteria 1516
31 Ga0068863_100029568 3300005841 Bacteria 5230
32 Ga0068863_100110410 3300005841 Bacteria 2619
33 Ga0068858_100206035 3300005842 Bacteria 1861
34 Ga0068858_100801831 3300005842 Bacteria 919
35 Ga0081455_10023449 3300005937 Bacteria 5741
36 Ga0070717_10011598 3300006028 Bacteria 6700
37 Ga0070717_10260300 3300006028 Bacteria 1535
38 Ga0070717_10383079 3300006028 Bacteria 1261
39 Ga0097621_100126425 3300006237 Bacteria 2172
40 Ga0075431_100006733 3300006847 Bacteria 11413
41 Ga0075431_100233441 3300006847 Bacteria 1873
42 Ga0075436_100024518 3300006914 Bacteria 4146
43 Ga0097620_100066477 3300006931 Bacteria 3640
44 Ga0097620_100376056 3300006931 Bacteria 1516
45 Ga0105240_10000585 3300009093 Bacteria 67528
46 Ga0105240_10001614 3300009093 Bacteria 38227
47 Ga0105240_10281939 3300009093 Bacteria 1908
48 Ga0105240_10336667 3300009093 Bacteria 1715
49 Ga0105245_10406076 3300009098 Bacteria 1362
50 Ga0105245_10714667 3300009098 Bacteria 1036
51 Ga0114129_10782810 3300009147 Unclassified 1219
52 Ga0105248_10061643 3300009177 Bacteria 4212
53 Ga0105248_10074915 3300009177 Bacteria 3804
54 Ga0105248_10159316 3300009177 Bacteria 2546
55 Ga0105237_10001911 3300009545 Bacteria 26586
56 Ga0105237_10510909 3300009545 Bacteria 1208
57 Ga0105238_10400917 3300009551 Unclassified 1365
58 Ga0105239_10318789 3300010375 Bacteria 1753
59 Ga0105239_10397708 3300010375 Bacteria 1559
60 Ga0157370_10003363 3300013104 Bacteria 18832
61 Ga0157370_10050143 3300013104 Unclassified 3992
62 Ga0157370_10291002 3300013104 Unclassified 1508
63 Ga0157370_10479683 3300013104 Bacteria 1143
64 Ga0157369_10003673 3300013105 Bacteria 18224
65 Ga0157369_10101063 3300013105 Bacteria 3074
66 Ga0157369_10177465 3300013105 Bacteria 2242
67 Ga0157369_10232099 3300013105 Bacteria 1929
68 Ga0157374_10186240 3300013296 Bacteria 2029
69 Ga0157378_10105398 3300013297 Bacteria 2578
70 Ga0157378_10341751 3300013297 Unclassified 1460
71 Ga0157372_10088095 3300013307 Bacteria 3524
72 Ga0157375_10542751 3300013308 Bacteria 1325
73 Ga0163163_10017999 3300014325 Bacteria 6600
74 Ga0157380_10338421 3300014326 Bacteria 1402
75 Ga0157379_10202429 3300014968 Bacteria 1795
76 Ga0157376_10476574 3300014969 Bacteria 1222
77 Ga0206356_10870879 3300020070 Bacteria 1119
78 Ga0206352_10535768 3300020078 Bacteria 1161
79 Ga0207705_10011673 3300025909 Bacteria 6347
80 Ga0207707_10027910 3300025912 Bacteria 4936
81 Ga0207707_10056267 3300025912 Bacteria 3422
82 Ga0207707_10069443 3300025912 Bacteria 3071
83 Ga0207707_10128228 3300025912 Bacteria 2218
84 Ga0207695_10000735 3300025913 Bacteria 63549
85 Ga0207695_10014399 3300025913 Bacteria 9375
86 Ga0207671_10016859 3300025914 Bacteria 5658
87 Ga0207671_10374920 3300025914 Unclassified 1130
88 Ga0207652_10224807 3300025921 Viruses 1691
89 Ga0207652_10362738 3300025921 Bacteria 1308
90 Ga0207700_10178094 3300025928 Bacteria 1778
91 Ga0207670_10060175 3300025936 Bacteria 2587
92 Ga0207711_10063994 3300025941 Bacteria 3176
93 Ga0207711_10127024 3300025941 Bacteria 2282
94 Ga0207661_10000011 3300025944 Bacteria 361200
95 Ga0207667_10008109 3300025949 Bacteria 12517
96 Ga0207667_10367897 3300025949 Bacteria 1466
97 Ga0207667_10385490 3300025949 Bacteria 1428
98 Ga0207703_10453029 3300026035 Bacteria 1199
99 Ga0207703_10656117 3300026035 Bacteria 996
100 Ga0207678_10206898 3300026067 Unclassified 1678
101 Ga0207678_10207112 3300026067 Bacteria 1678
102 Ga0207641_10010596 3300026088 Bacteria 7564
103 Ga0207698_10012423 3300026142 Bacteria 5571
104 Ga0268266_10257542 3300028379 Bacteria 1616
105 Ga0307516_10009418 3300031730 Bacteria 10891
106 Ga0373926_0004130 3300035083 Bacteria 4744
107 Ga0373926_0009314 3300035083 Unclassified 3280
108 Ga0373953_0064773 3300035117 Bacteria 1500
109 Ga0373956_0177132 3300035119 Bacteria 1007
110 Ga0373931_0104215 3300035691 Bacteria 1600
111 Ga0373931_0196066 3300035691 Unclassified 1204
112 Ga0373935_0280403 3300035692 Bacteria 1173
113 Ga0373935_0422634 3300035692 Unclassified 960
114 Ga0373927_0002089 3300035695 Bacteria 14750
115 Ga0373927_0003298 3300035695 Bacteria 11618
116 Ga0373927_0022093 3300035695 Bacteria 4169
117 Ga0373947_0001970 3300035725 Bacteria 12576
118 Ga0373947_0180867 3300035725 Bacteria 1373
119 Ga0373947_0234876 3300035725 Bacteria 1209
120 Ga0373937_0030397 3300036401 Bacteria 4894
121 Ga0373925_0000102 3300037068 Bacteria 92826
122 Ga0373925_0000346 3300037068 Bacteria 48107
123 Ga0373925_0235861 3300037068 Bacteria 1464
124 Ga0395898_0056138 3300037466 Bacteria 3840
125 Ga0436360_1065093 3300039438 Bacteria 1646
126 Ga0453684_0307910 3300044712 Bacteria 1799
127 Ga0453684_0607413 3300044712 Bacteria 1198
128 Ga0451576_0058906 3300045051 Bacteria 4011
129 Ga0451576_0202153 3300045051 Bacteria 2075
130 Ga0451576_0454972 3300045051 Bacteria 1344
131 Ga0495592_0139749 3300046454 Bacteria 1686
132 Ga0495580_0000799 3300046472 Bacteria 27233
133 Ga0495580_0045946 3300046472 Bacteria 3100
134 Ga0495580_0224903 3300046472 Unclassified 1289
135 Ga0495580_0342871 3300046472 Unclassified 1013
136 Ga0495582_0055053 3300046473 Bacteria 2193
137 Ga0495662_0072315 3300046476 Bacteria 1672
138 Ga0495664_0222911 3300046477 Bacteria 1141
139 Ga0495594_0014633 3300046499 Bacteria 4114
140 Ga0495665_0032491 3300046531 Unclassified 2792
141 Ga0495665_0034518 3300046531 Bacteria 2705
142 Ga0495645_0032560 3300046543 Bacteria 3803
143 Ga0495645_0083468 3300046543 Bacteria 2290
144 Ga0495667_0126746 3300046559 Bacteria 1647
145 Ga0495635_0070286 3300046663 Bacteria 2400
146 Ga0495646_0136795 3300046680 Bacteria 1374
147 Ga0495604_0026857 3300047317 Bacteria 4582
148 Ga0495674_0010519 3300047319 Bacteria 8757
149 Ga0495674_0576939 3300047319 Bacteria 893
150 Ga0495675_0038216 3300047444 Bacteria 3056
151 Ga0495675_0076772 3300047444 Bacteria 2105
152 Ga0495614_0110090 3300048089 Bacteria 1209
153 Ga0496112_0396554 3300048915 Bacteria 1320
154 Ga0501032_0086794 3300049569 Unclassified 2079
155 Ga0501033_0498927 3300049570 Bacteria 842
156 Ga0501034_0045149 3300049571 Bacteria 4453
157 Ga0501040_0273131 3300049576 Bacteria 1207
158 Ga0501043_0042323 3300049579 Bacteria 3580
159 Ga0501047_0043778 3300049581 Unclassified 4324
160 Ga0501070_0004505 3300049586 Bacteria 11961
161 Ga0501070_0093872 3300049586 Viruses 2482
162 Ga0501073_0051752 3300049589 Unclassified 2877
163 Ga0501073_0052649 3300049589 Bacteria 2850
164 Ga0501074_0075154 3300049590 Bacteria 2426
165 Ga0501075_0259305 3300049591 Unclassified 1325
166 Ga0501081_0299983 3300049743 Bacteria 1179
167 Ga0501035_0031034 3300049822 Bacteria 4867
168 Ga0501044_0022562 3300049823 Bacteria 6707
169 Ga0501044_0030176 3300049823 Bacteria 5715
170 nmdc:mga05p37_283187_c1 3300050507 Bacteria 1976
171 nmdc:mga06r32_28192_c1 3300050510 Bacteria 5251
172 nmdc:mga06r32_67696_c1 3300050510 Bacteria 3448
173 nmdc:mga08x19_179305_c1 3300050514 Bacteria 1445
174 nmdc:mga08x19_2910_c1 3300050514 Bacteria 10296
175 2889792862 2889790730 Bacteria 5689708
176 2889915017 2889914905 Bacteria 5702301
177 Ga0105240_10001660
178 Ga0070658_10096954
179 Ga0070683_100000006
180 Ga0070683_100028231
181 Ga0070670_100247042
182 Ga0070680_100000906
183 Ga0070660_100130592
184 Ga0070688_100276304
185 Ga0070713_100223444
186 Ga0070713_100256415
187 Ga0070681_10036327
188 Ga0070681_10071210
189 Ga0070681_10128698
190 Ga0070681_10252450
191 Ga0070685_10069019
192 Ga0070706_100129933
193 Ga0070699_100186687
194 Ga0070699_100524230
195 Ga0070684_100000050
196 Ga0070697_100451984
197 Ga0070672_100486596
198 Ga0070696_100113736
199 Ga0070665_100308817
200 Ga0068855_100007695
201 Ga0068855_100031200
202 Ga0068855_100200474
203 Ga0068856_100038992
204 Ga0068852_100007159
205 Ga0068859_100066474
206 Ga0068859_100376015
207 Ga0068863_100029568
208 Ga0068863_100110410
209 Ga0068858_100206035
210 Ga0068858_100801831
211 Ga0081455_10023449
212 Ga0070717_10011598
213 Ga0070717_10260300
214 Ga0070717_10383079
215 Ga0097621_100126425
216 Ga0075431_100006733
217 Ga0075431_100233441
218 Ga0075436_100024518
219 Ga0097620_100066477
220 Ga0097620_100376056
221 Ga0105240_10000585
222 Ga0105240_10001614
223 Ga0105240_10281939
224 Ga0105240_10336667
225 Ga0105245_10406076
226 Ga0105245_10714667
227 Ga0114129_10782810
228 Ga0105248_10061643
229 Ga0105248_10074915
230 Ga0105248_10159316
231 Ga0105237_10001911
232 Ga0105237_10510909
233 Ga0105238_10400917
234 Ga0105239_10318789
235 Ga0105239_10397708
236 Ga0157370_10003363
237 Ga0157370_10050143
238 Ga0157370_10291002
239 Ga0157370_10479683
240 Ga0157369_10003673
241 Ga0157369_10101063
242 Ga0157369_10177465
243 Ga0157369_10232099
244 Ga0157374_10186240
245 Ga0157378_10105398
246 Ga0157378_10341751
247 Ga0157372_10088095
248 Ga0157375_10542751
249 Ga0163163_10017999
250 Ga0157380_10338421
251 Ga0157379_10202429
252 Ga0157376_10476574
253 Ga0206356_10870879
254 Ga0206352_10535768
255 Ga0207705_10011673
256 Ga0207707_10027910
257 Ga0207707_10056267
258 Ga0207707_10069443
259 Ga0207707_10128228
260 Ga0207695_10000735
261 Ga0207695_10014399
262 Ga0207671_10016859
263 Ga0207671_10374920
264 Ga0207652_10224807
265 Ga0207652_10362738
266 Ga0207700_10178094
267 Ga0207670_10060175
268 Ga0207711_10063994
269 Ga0207711_10127024
270 Ga0207661_10000011
271 Ga0207667_10008109
272 Ga0207667_10367897
273 Ga0207667_10385490
274 Ga0207703_10453029
275 Ga0207703_10656117
276 Ga0207678_10206898
277 Ga0207678_10207112
278 Ga0207641_10010596
279 Ga0207698_10012423
280 Ga0268266_10257542
281 Ga0307516_10009418
282 Ga0373926_0004130
283 Ga0373926_0009314
284 Ga0373953_0064773
285 Ga0373956_0177132
286 Ga0373931_0104215
287 Ga0373931_0196066
288 Ga0373935_0280403
289 Ga0373935_0422634
290 Ga0373927_0002089
291 Ga0373927_0003298
292 Ga0373927_0022093
293 Ga0373947_0001970
294 Ga0373947_0180867
295 Ga0373947_0234876
296 Ga0373937_0030397
297 Ga0373925_0000102
298 Ga0373925_0000346
299 Ga0373925_0235861
300 Ga0395898_0056138
301 Ga0436360_1065093
302 Ga0453684_0307910
303 Ga0453684_0607413
304 Ga0451576_0058906
305 Ga0451576_0202153
306 Ga0451576_0454972
307 Ga0495592_0139749
308 Ga0495580_0000799
309 Ga0495580_0045946
310 Ga0495580_0224903
311 Ga0495580_0342871
312 Ga0495582_0055053
313 Ga0495662_0072315
314 Ga0495664_0222911
315 Ga0495594_0014633
316 Ga0495665_0032491
317 Ga0495665_0034518
318 Ga0495645_0032560
319 Ga0495645_0083468
320 Ga0495667_0126746
321 Ga0495635_0070286
322 Ga0495646_0136795
323 Ga0495604_0026857
324 Ga0495674_0010519
325 Ga0495674_0576939
326 Ga0495675_0038216
327 Ga0495675_0076772
328 Ga0495614_0110090
329 Ga0496112_0396554
330 Ga0501032_0086794
331 Ga0501033_0498927
332 Ga0501034_0045149
333 Ga0501040_0273131
334 Ga0501043_0042323
335 Ga0501047_0043778
336 Ga0501070_0004505
337 Ga0501070_0093872
338 Ga0501073_0051752
339 Ga0501073_0052649
340 Ga0501074_0075154
341 Ga0501075_0259305
342 Ga0501081_0299983
343 Ga0501035_0031034
344 Ga0501044_0022562
345 Ga0501044_0030176
346 nmdc:mga05p37_283187_c1
347 nmdc:mga06r32_28192_c1
348 nmdc:mga06r32_67696_c1
349 nmdc:mga08x19_179305_c1
350 nmdc:mga08x19_2910_c1
351 2889792862
352 2889915017

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

41

295

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zvr-assembly1.cif.gz_B crystal structure of a d-tagatose 3-epimerase-related protein from thermotoga maritima 0.8812 5 278
2zvr-assembly1.cif.gz_B crystal structure of a d-tagatose 3-epimerase-related protein from thermotoga maritima 0.8654 5 278
5h6h-assembly2.cif.gz_B crystal structure of hyperthermophilic thermotoga maritima l-ribulose 3-epimerase with mn2+ 0.8608 5 278
6wn6-assembly1.cif.gz_A crystal structure of 3-keto-d-glucoside 4-epimerase, ycjr, from e. coli, apo form 0.8576 5 277
5h6h-assembly2.cif.gz_B crystal structure of hyperthermophilic thermotoga maritima l-ribulose 3-epimerase with mn2+ 0.8487 5 278
ID Description Score Start End Superfamily
af_P45541_1_270_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8723 5 277 3.20.20.150
af_P45541_1_270_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8665 5 277 3.20.20.150
5h1wA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8451 5 279 3.20.20.150
af_P76044_1_262_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8419 5 277 3.20.20.150
af_P76044_1_262_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8359 5 277 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A2N9MGW6-F1-model_v4 NAD-dependent epimerase/dehydratase (Modular protein) 0.9904 5 277
AF-A0A3D1AYA4-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9848 9 277 GO:0016853
AF-A0A7V2MFK4-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9811 5 278 GO:0016853
AF-A0A350UI91-F1-model_v4 Sugar phosphate isomerase/epimerase 0.98 47 278 GO:0016853
AF-A0A7Y8M0U8-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9786 4 278 GO:0016853

Map