F267949

General Info

Members Datasets Scaffolds Average Seq Length
176 105 169 272

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100016559|Ga0068856_1000165592
Length 310
Sequence MKTLENHLILFDAECPMCDAYTRAFVKTGMLGNKGRAAYQSEINAACPVIDKQRAANEIALVDLDSGEVIYGIKSLFKIIGNAWPLFRPLFSFKPFIWLMSKIYAFVAYNRRVIIPAGKTGGAYTYQPAFKIHYRIAYLLFTWFCTGFILSRYVQLLTGLLPAGGQWREYFICGGQIIFQGIIISTFAKDRLWNYLGNMMTISFGGGLLLLLPLITGIWISIPTFYFAAYFMGVAGLMLLEHIRRTKLMNLGWTLTITWVLYRVYKSMSFRRGTRRKLFGLCMRITQSLKSFLTSFEMTRCLFFTRNLYH

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2738541284 Pedobacter sp. YR016 Isolate Unclassified
3 2739367663 Pedobacter sp. YR510 Isolate Unclassified
4 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
5 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
6 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
7 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
8 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
47 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
48 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
71 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
72 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
75 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
76 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
77 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
78 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
79 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
80 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
81 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
82 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
83 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
84 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
85 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
86 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
87 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
88 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
89 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
90 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
91 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
92 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
93 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
94 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
95 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
96 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
97 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
98 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
99 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
100 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
101 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
102 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
103 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
104 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
105 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.02
Metatranscriptomes 0
Isolates 3.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.25
Nodule 0
Rhizoplane 0.57
Rhizosphere 84.66
Stem 0
Stem Tuber 0
Unclassified 8.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001902 3300001904 Bacteria 3717
2 JGI24737J22298_10001219 3300001990 Bacteria 9071
3 JGI24735J21928_10000011 3300002067 Bacteria 217841
4 JGI25162J39368_1000088 3300002737 Bacteria 106999
5 rootH1_10002333 3300003316 Bacteria 10037
6 rootH2_10003875 3300003320 Bacteria 32454
7 rootH2_10175660 3300003320 Unclassified 1663
8 rootH1_10028499 3300003323 Bacteria 5648
9 rootH1_10258398 3300003323 Unclassified 3614
10 Ga0065714_10018864 3300005288 Bacteria 1952
11 Ga0065714_10066636 3300005288 Bacteria 6525
12 Ga0070658_10008887 3300005327 Bacteria 8076
13 Ga0070676_10000806 3300005328 Bacteria 15501
14 Ga0068868_100479533 3300005338 Bacteria 1086
15 Ga0070673_100059507 3300005364 Bacteria 3024
16 Ga0070659_100119610 3300005366 Bacteria 2132
17 Ga0070662_100000853 3300005457 Bacteria 18740
18 Ga0070679_100039304 3300005530 Bacteria 4703
19 Ga0070665_100000367 3300005548 Bacteria 67579
20 Ga0068855_100000311 3300005563 Bacteria 60403
21 Ga0068855_100000426 3300005563 Bacteria 52084
22 Ga0068855_100026628 3300005563 Bacteria 6919
23 Ga0068855_100143246 3300005563 Bacteria 2722
24 Ga0068855_100362152 3300005563 Bacteria 1595
25 Ga0068856_100005057 3300005614 Bacteria 13053
26 Ga0068856_100015896 3300005614 Bacteria 7276
27 Ga0068856_100016559 3300005614 Bacteria 7136
28 Ga0068856_100687727 3300005614 Bacteria 1043
29 Ga0068852_100031398 3300005616 Bacteria 4382
30 Ga0068852_100181950 3300005616 Bacteria 1977
31 Ga0075366_10000471 3300006195 Bacteria 18733
32 Ga0097621_100000418 3300006237 Bacteria 29674
33 Ga0097621_100343279 3300006237 Bacteria 1326
34 Ga0068871_100000043 3300006358 Bacteria 67759
35 Ga0105240_10002753 3300009093 Bacteria 27789
36 Ga0105240_10003133 3300009093 Bacteria 26043
37 Ga0105240_10015079 3300009093 Bacteria 10520
38 Ga0105240_10019406 3300009093 Bacteria 9084
39 Ga0105240_10031899 3300009093 Bacteria 6827
40 Ga0105240_10087698 3300009093 Bacteria 3810
41 Ga0105240_10099492 3300009093 Bacteria 3539
42 Ga0105240_10124571 3300009093 Bacteria 3099
43 Ga0105240_10173135 3300009093 Bacteria 2554
44 Ga0105240_10203219 3300009093 Bacteria 2320
45 Ga0105241_10000784 3300009174 Bacteria 24141
46 Ga0105241_10007047 3300009174 Bacteria 8275
47 Ga0105241_10052095 3300009174 Bacteria 3124
48 Ga0105241_10099663 3300009174 Bacteria 2308
49 Ga0105237_10000620 3300009545 Bacteria 49579
50 Ga0105237_10001576 3300009545 Bacteria 29681
51 Ga0105237_10002830 3300009545 Bacteria 21104
52 Ga0105237_10618472 3300009545 Unclassified 1090
53 Ga0105238_10061390 3300009551 Bacteria 3762
54 Ga0105238_10064031 3300009551 Bacteria 3678
55 Ga0105239_10000045 3300010375 Bacteria 186314
56 Ga0105239_10000087 3300010375 Bacteria 129698
57 Ga0105239_10005247 3300010375 Bacteria 15243
58 Ga0105239_10089712 3300010375 Bacteria 3390
59 Ga0105246_10011207 3300011119 Bacteria 5558
60 Ga0105246_10168284 3300011119 Bacteria 1676
61 Ga0157373_10015985 3300013100 Bacteria 5479
62 Ga0157371_10034670 3300013102 Bacteria 3619
63 Ga0157374_10000393 3300013296 Bacteria 39683
64 Ga0157374_10000575 3300013296 Bacteria 32602
65 Ga0163162_10000457 3300013306 Bacteria 37808
66 Ga0163162_10018835 3300013306 Bacteria 6768
67 Ga0163162_10063550 3300013306 Bacteria 3734
68 Ga0157372_10000870 3300013307 Bacteria 32811
69 Ga0157372_10121211 3300013307 Bacteria 3004
70 Ga0157375_10003673 3300013308 Bacteria 13321
71 Ga0163163_10046902 3300014325 Unclassified 4245
72 Ga0182008_10000006 3300014497 Bacteria 378521
73 Ga0157377_10013881 3300014745 Bacteria 4086
74 Ga0163161_10000094 3300017792 Bacteria 90423
75 Ga0209437_100190 3300025233 Bacteria 125000
76 Ga0209129_1012679 3300025258 Bacteria 1912
77 Ga0209455_1002144 3300025272 Bacteria 7826
78 Ga0207647_10000495 3300025904 Bacteria 31517
79 Ga0207645_10000205 3300025907 Bacteria 48288
80 Ga0207705_10132193 3300025909 Bacteria 1858
81 Ga0207654_10002717 3300025911 Bacteria 8981
82 Ga0207707_10155205 3300025912 Bacteria 2002
83 Ga0207695_10002377 3300025913 Bacteria 27917
84 Ga0207695_10002475 3300025913 Bacteria 27204
85 Ga0207695_10039688 3300025913 Bacteria 5057
86 Ga0207695_10059404 3300025913 Bacteria 3964
87 Ga0207695_10098708 3300025913 Bacteria 2919
88 Ga0207695_10124116 3300025913 Bacteria 2546
89 Ga0207695_10319380 3300025913 Unclassified 1442
90 Ga0207671_10001560 3300025914 Bacteria 26209
91 Ga0207671_10002524 3300025914 Bacteria 19503
92 Ga0207671_10014770 3300025914 Bacteria 6154
93 Ga0207671_10490805 3300025914 Unclassified 979
94 Ga0207660_10021618 3300025917 Bacteria 4328
95 Ga0207652_10031447 3300025921 Bacteria 4458
96 Ga0207694_10203285 3300025924 Bacteria 1612
97 Ga0207690_10127619 3300025932 Bacteria 1857
98 Ga0207706_10000553 3300025933 Bacteria 39805
99 Ga0207691_10136297 3300025940 Bacteria 2165
100 Ga0207667_10000030 3300025949 Bacteria 327226
101 Ga0207667_10007518 3300025949 Bacteria 13078
102 Ga0207667_10015815 3300025949 Bacteria 8551
103 Ga0207667_10029305 3300025949 Bacteria 5971
104 Ga0207651_10024816 3300025960 Bacteria 3715
105 Ga0207677_10480833 3300026023 Bacteria 1070
106 Ga0207639_10023833 3300026041 Bacteria 4423
107 Ga0207702_10004472 3300026078 Bacteria 12417
108 Ga0207702_10509413 3300026078 Bacteria 1174
109 Ga0207683_10112140 3300026121 Bacteria 2442
110 Ga0207698_10074825 3300026142 Bacteria 2703
111 Ga0268266_10000053 3300028379 Bacteria 295181
112 Ga0307517_10000515 3300028786 Bacteria 66157
113 Ga0307515_10000510 3300028794 Bacteria 92702
114 Ga0307515_10000667 3300028794 Bacteria 79135
115 Ga0307509_10178728 3300031507 Bacteria 1991
116 Ga0307414_10003769 3300032004 Bacteria 8146
117 Ga0307507_10000111 3300033179 Bacteria 134722
118 Ga0307510_10002629 3300033180 Bacteria 20503
119 Ga0495638_0104711 3300046460 Bacteria 1687
120 Ga0495651_0299066 3300046462 Bacteria 1080
121 Ga0495650_0000330 3300046471 Bacteria 84849
122 Ga0495585_0000280 3300046492 Bacteria 51045
123 Ga0495585_0001924 3300046492 Bacteria 15543
124 Ga0495583_0072959 3300046506 Bacteria 1505
125 Ga0495606_0000036 3300046507 Bacteria 234596
126 Ga0495606_0009863 3300046507 Bacteria 8009
127 Ga0495606_0015355 3300046507 Bacteria 5906
128 Ga0495610_0000333 3300046512 Bacteria 49816
129 Ga0495610_0019042 3300046512 Bacteria 3855
130 Ga0495610_0093769 3300046512 Bacteria 1356
131 Ga0495616_0002462 3300046513 Bacteria 12275
132 Ga0495616_0016500 3300046513 Bacteria 4086
133 Ga0495648_0019225 3300046524 Bacteria 4811
134 Ga0495609_0001012 3300046538 Bacteria 19994
135 Ga0495633_0000082 3300046558 Bacteria 125101
136 Ga0495633_0005783 3300046558 Bacteria 7468
137 Ga0495668_0000017 3300046616 Bacteria 434025
138 Ga0495668_0163471 3300046616 Bacteria 1219
139 Ga0495611_0106201 3300046648 Bacteria 1306
140 Ga0495625_0000007 3300046660 Bacteria 565749
141 Ga0495625_0000155 3300046660 Bacteria 105066
142 Ga0495625_0000589 3300046660 Bacteria 52785
143 Ga0495625_0008943 3300046660 Bacteria 8463
144 Ga0495625_0009176 3300046660 Bacteria 8312
145 Ga0495625_0037105 3300046660 Bacteria 3577
146 Ga0495625_0041934 3300046660 Unclassified 3328
147 Ga0495625_0059698 3300046660 Bacteria 2705
148 Ga0495658_0031746 3300046683 Bacteria 2879
149 Ga0495671_0184550 3300046692 Bacteria 1013
150 Ga0495649_0000038 3300046694 Bacteria 128764
151 Ga0495660_0020471 3300046810 Bacteria 3792
152 Ga0495683_0093979 3300047323 Bacteria 1449
153 Ga0495687_024988 3300047443 Bacteria 2831
154 Ga0495679_030937 3300047446 Bacteria 1732
155 Ga0495673_0065889 3300047469 Bacteria 1537
156 Ga0495686_0000066 3300047472 Bacteria 225023
157 Ga0495686_0001123 3300047472 Bacteria 31643
158 Ga0495686_0005774 3300047472 Bacteria 9667
159 Ga0495686_0079524 3300047472 Unclassified 2005
160 Ga0495686_0177405 3300047472 Bacteria 1236
161 Ga0495626_0108949 3300048091 Bacteria 1201
162 Ga0495682_0024631 3300049460 Bacteria 2243
163 Ga0501241_008666 3300049758 Bacteria 1855
164 nmdc:mga0k408_20026_c1 3300050493 Bacteria 2591
165 nmdc:mga0k408_57_c1 3300050493 Bacteria 56021
166 Ga0500608_016678 3300053122 Bacteria 3322
167 Ga0500618_000033 3300053125 Bacteria 121886
168 Ga0500618_012861 3300053125 Bacteria 2180
169 Ga0500624_000646 3300053157 Bacteria 9211

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013102 Ga0157371_10034670 Ga0157371_100346702 224
2 3300047472 Ga0495686_0079524 Ga0495686_0079524_10_705 231
3 3300009093 Ga0105240_10003133 Ga0105240_1000313314 254
4 3300009545 Ga0105237_10618472 Ga0105237_106184721 254
5 3300025913 Ga0207695_10002475 Ga0207695_1000247516 254
6 3300025914 Ga0207671_10490805 Ga0207671_104908052 254
7 3300049758 Ga0501241_008666 Ga0501241_008666_26_799 255
8 3300050493 nmdc:mga0k408_20026_c1 nmdc:mga0k408_20026_c1_465_1235 256
9 3300046507 Ga0495606_0009863 Ga0495606_0009863_4207_5049 259
10 3300017792 Ga0163161_10000094 Ga0163161_1000009415 260
11 3300009093 Ga0105240_10002753 Ga0105240_1000275315 261
12 3300025913 Ga0207695_10002377 Ga0207695_1000237715 261
13 iso_pu_bacteria 2739367663 2739645609 266
14 iso_pu_bacteria 2738541284 2738760294 267
15 3300003320 rootH2_10175660 rootH2_101756602 268
16 iso_pu_bacteria 2919437846 2919440020 268
17 iso_pu_bacteria 2928078545 2928081360 268
18 iso_pu_bacteria 2928147474 2928150467 268
19 3300005563 Ga0068855_100000426 Ga0068855_10000042627 269
20 3300014325 Ga0163163_10046902 Ga0163163_100469022 269
21 3300025949 Ga0207667_10007518 Ga0207667_1000751811 269
22 3300005614 Ga0068856_100005057 Ga0068856_10000505710 270
23 3300005614 Ga0068856_100687727 Ga0068856_1006877271 270
24 3300005616 Ga0068852_100181950 Ga0068852_1001819502 270
25 3300006195 Ga0075366_10000471 Ga0075366_100004718 270
26 3300009093 Ga0105240_10124571 Ga0105240_101245712 270
27 3300026078 Ga0207702_10004472 Ga0207702_100044725 270
28 3300028794 Ga0307515_10000510 Ga0307515_1000051052 270
29 3300028794 Ga0307515_10000667 Ga0307515_1000066734 270
30 3300033179 Ga0307507_10000111 Ga0307507_100001117 270
31 3300046492 Ga0495585_0001924 Ga0495585_0001924_14624_15442 270
32 3300046512 Ga0495610_0093769 Ga0495610_0093769_322_1140 270
33 3300046524 Ga0495648_0019225 Ga0495648_0019225_3932_4750 270
34 3300046538 Ga0495609_0001012 Ga0495609_0001012_3271_4089 270
35 3300046558 Ga0495633_0000082 Ga0495633_0000082_94406_95224 270
36 3300046616 Ga0495668_0000017 Ga0495668_0000017_94353_95171 270
37 3300046660 Ga0495625_0000155 Ga0495625_0000155_54864_55682 270
38 3300046660 Ga0495625_0000589 Ga0495625_0000589_10323_11141 270
39 3300046660 Ga0495625_0008943 Ga0495625_0008943_3141_3959 270
40 3300046683 Ga0495658_0031746 Ga0495658_0031746_1594_2412 270
41 3300048091 Ga0495626_0108949 Ga0495626_0108949_197_1015 270
42 3300049460 Ga0495682_0024631 Ga0495682_0024631_403_1221 270
43 3300050493 nmdc:mga0k408_57_c1 nmdc:mga0k408_57_c1_15519_16337 270
44 3300053122 Ga0500608_016678 Ga0500608_016678_1127_1945 270
45 3300053125 Ga0500618_000033 Ga0500618_000033_33235_34053 270
46 3300003323 rootH1_10258398 rootH1_102583983 271
47 3300005288 Ga0065714_10018864 Ga0065714_100188643 271
48 3300005288 Ga0065714_10066636 Ga0065714_100666365 271
49 3300005563 Ga0068855_100000311 Ga0068855_10000031133 271
50 3300009093 Ga0105240_10019406 Ga0105240_100194064 271
51 3300009093 Ga0105240_10031899 Ga0105240_100318994 271
52 3300009093 Ga0105240_10087698 Ga0105240_100876982 271
53 3300009174 Ga0105241_10052095 Ga0105241_100520952 271
54 3300009174 Ga0105241_10099663 Ga0105241_100996632 271
55 3300009545 Ga0105237_10000620 Ga0105237_1000062051 271
56 3300009551 Ga0105238_10061390 Ga0105238_100613901 271
57 3300010375 Ga0105239_10000045 Ga0105239_1000004552 271
58 3300014497 Ga0182008_10000006 Ga0182008_10000006211 271
59 3300025272 Ga0209455_1002144 Ga0209455_10021444 271
60 3300025913 Ga0207695_10039688 Ga0207695_100396885 271
61 3300025949 Ga0207667_10000030 Ga0207667_10000030116 271
62 3300031507 Ga0307509_10178728 Ga0307509_101787282 271
63 3300032004 Ga0307414_10003769 Ga0307414_100037692 271
64 3300046462 Ga0495651_0299066 Ga0495651_0299066_41_862 271
65 3300047472 Ga0495686_0000066 Ga0495686_0000066_89025_89843 271
66 3300047472 Ga0495686_0005774 Ga0495686_0005774_5030_5851 271
67 3300001904 JGI24736J21556_1001902 JGI24736J21556_10019023 272
68 3300001990 JGI24737J22298_10001219 JGI24737J22298_1000121910 272
69 3300002067 JGI24735J21928_10000011 JGI24735J21928_1000001132 272
70 3300002737 JGI25162J39368_1000088 JGI25162J39368_100008815 272
71 3300003316 rootH1_10002333 rootH1_100023333 272
72 3300003320 rootH2_10003875 rootH2_1000387514 272
73 3300003323 rootH1_10028499 rootH1_100284996 272
74 3300005327 Ga0070658_10008887 Ga0070658_100088879 272
75 3300005328 Ga0070676_10000806 Ga0070676_1000080612 272
76 3300005338 Ga0068868_100479533 Ga0068868_1004795332 272
77 3300005364 Ga0070673_100059507 Ga0070673_1000595073 272
78 3300005366 Ga0070659_100119610 Ga0070659_1001196102 272
79 3300005457 Ga0070662_100000853 Ga0070662_1000008534 272
80 3300005530 Ga0070679_100039304 Ga0070679_1000393041 272
81 3300005548 Ga0070665_100000367 Ga0070665_10000036759 272
82 3300005563 Ga0068855_100026628 Ga0068855_1000266288 272
83 3300005563 Ga0068855_100143246 Ga0068855_1001432463 272
84 3300005563 Ga0068855_100362152 Ga0068855_1003621522 272
85 3300005614 Ga0068856_100015896 Ga0068856_1000158964 272
86 3300005614 Ga0068856_100016559 Ga0068856_1000165592 272
87 3300005616 Ga0068852_100031398 Ga0068852_1000313984 272
88 3300006237 Ga0097621_100000418 Ga0097621_10000041819 272
89 3300006237 Ga0097621_100343279 Ga0097621_1003432792 272
90 3300006358 Ga0068871_100000043 Ga0068871_10000004317 272
91 3300009093 Ga0105240_10015079 Ga0105240_100150799 272
92 3300009093 Ga0105240_10099492 Ga0105240_100994924 272
93 3300009093 Ga0105240_10173135 Ga0105240_101731353 272
94 3300009093 Ga0105240_10203219 Ga0105240_102032192 272
95 3300009174 Ga0105241_10000784 Ga0105241_1000078418 272
96 3300009174 Ga0105241_10007047 Ga0105241_100070478 272
97 3300009545 Ga0105237_10001576 Ga0105237_1000157611 272
98 3300009545 Ga0105237_10002830 Ga0105237_100028304 272
99 3300009551 Ga0105238_10064031 Ga0105238_100640314 272
100 3300010375 Ga0105239_10000087 Ga0105239_1000008742 272
101 3300010375 Ga0105239_10005247 Ga0105239_1000524715 272
102 3300010375 Ga0105239_10089712 Ga0105239_100897122 272
103 3300011119 Ga0105246_10011207 Ga0105246_100112079 272
104 3300011119 Ga0105246_10168284 Ga0105246_101682843 272
105 3300013100 Ga0157373_10015985 Ga0157373_100159853 272
106 3300013296 Ga0157374_10000393 Ga0157374_1000039316 272
107 3300013296 Ga0157374_10000575 Ga0157374_1000057519 272
108 3300013306 Ga0163162_10000457 Ga0163162_1000045731 272
109 3300013306 Ga0163162_10018835 Ga0163162_100188355 272
110 3300013306 Ga0163162_10063550 Ga0163162_100635503 272
111 3300013307 Ga0157372_10000870 Ga0157372_100008703 272
112 3300013307 Ga0157372_10121211 Ga0157372_101212114 272
113 3300013308 Ga0157375_10003673 Ga0157375_1000367310 272
114 3300014745 Ga0157377_10013881 Ga0157377_100138814 272
115 3300025233 Ga0209437_100190 Ga0209437_10019095 272
116 3300025258 Ga0209129_1012679 Ga0209129_10126791 272
117 3300025904 Ga0207647_10000495 Ga0207647_1000049516 272
118 3300025907 Ga0207645_10000205 Ga0207645_1000020535 272
119 3300025909 Ga0207705_10132193 Ga0207705_101321932 272
120 3300025911 Ga0207654_10002717 Ga0207654_100027174 272
121 3300025912 Ga0207707_10155205 Ga0207707_101552053 272
122 3300025913 Ga0207695_10059404 Ga0207695_100594044 272
123 3300025913 Ga0207695_10098708 Ga0207695_100987082 272
124 3300025913 Ga0207695_10124116 Ga0207695_101241163 272
125 3300025913 Ga0207695_10319380 Ga0207695_103193802 272
126 3300025914 Ga0207671_10001560 Ga0207671_1000156017 272
127 3300025914 Ga0207671_10002524 Ga0207671_1000252411 272
128 3300025914 Ga0207671_10014770 Ga0207671_100147706 272
129 3300025917 Ga0207660_10021618 Ga0207660_100216185 272
130 3300025921 Ga0207652_10031447 Ga0207652_100314471 272
131 3300025924 Ga0207694_10203285 Ga0207694_102032852 272
132 3300025932 Ga0207690_10127619 Ga0207690_101276192 272
133 3300025933 Ga0207706_10000553 Ga0207706_1000055315 272
134 3300025940 Ga0207691_10136297 Ga0207691_101362972 272
135 3300025949 Ga0207667_10015815 Ga0207667_100158157 272
136 3300025949 Ga0207667_10029305 Ga0207667_100293053 272
137 3300025960 Ga0207651_10024816 Ga0207651_100248164 272
138 3300026023 Ga0207677_10480833 Ga0207677_104808332 272
139 3300026041 Ga0207639_10023833 Ga0207639_100238332 272
140 3300026078 Ga0207702_10509413 Ga0207702_105094132 272
141 3300026121 Ga0207683_10112140 Ga0207683_101121403 272
142 3300026142 Ga0207698_10074825 Ga0207698_100748254 272
143 3300028379 Ga0268266_10000053 Ga0268266_10000053210 272
144 3300028786 Ga0307517_10000515 Ga0307517_1000051511 272
145 3300033180 Ga0307510_10002629 Ga0307510_1000262911 272
146 3300046460 Ga0495638_0104711 Ga0495638_0104711_51_872 272
147 3300046471 Ga0495650_0000330 Ga0495650_0000330_58607_59428 272
148 3300046492 Ga0495585_0000280 Ga0495585_0000280_49478_50299 272
149 3300046506 Ga0495583_0072959 Ga0495583_0072959_27_848 272
150 3300046507 Ga0495606_0000036 Ga0495606_0000036_230252_231073 272
151 3300046507 Ga0495606_0015355 Ga0495606_0015355_3189_4013 272
152 3300046512 Ga0495610_0000333 Ga0495610_0000333_26421_27242 272
153 3300046512 Ga0495610_0019042 Ga0495610_0019042_2408_3229 272
154 3300046513 Ga0495616_0002462 Ga0495616_0002462_9014_9835 272
155 3300046513 Ga0495616_0016500 Ga0495616_0016500_1866_2690 272
156 3300046558 Ga0495633_0005783 Ga0495633_0005783_1749_2570 272
157 3300046616 Ga0495668_0163471 Ga0495668_0163471_240_1061 272
158 3300046648 Ga0495611_0106201 Ga0495611_0106201_77_901 272
159 3300046660 Ga0495625_0000007 Ga0495625_0000007_485868_486689 272
160 3300046660 Ga0495625_0009176 Ga0495625_0009176_2538_3362 272
161 3300046660 Ga0495625_0037105 Ga0495625_0037105_605_1429 272
162 3300046660 Ga0495625_0041934 Ga0495625_0041934_2360_3184 272
163 3300046660 Ga0495625_0059698 Ga0495625_0059698_30_854 272
164 3300046692 Ga0495671_0184550 Ga0495671_0184550_114_935 272
165 3300046694 Ga0495649_0000038 Ga0495649_0000038_78897_79718 272
166 3300046810 Ga0495660_0020471 Ga0495660_0020471_2778_3596 272
167 3300047323 Ga0495683_0093979 Ga0495683_0093979_570_1391 272
168 3300047443 Ga0495687_024988 Ga0495687_024988_1087_1908 272
169 3300047446 Ga0495679_030937 Ga0495679_030937_141_962 272
170 3300047469 Ga0495673_0065889 Ga0495673_0065889_83_904 272
171 3300047472 Ga0495686_0001123 Ga0495686_0001123_17153_17977 272
172 3300047472 Ga0495686_0177405 Ga0495686_0177405_31_849 272
173 3300053125 Ga0500618_012861 Ga0500618_012861_613_1440 272
174 3300053157 Ga0500624_000646 Ga0500624_000646_5499_6323 272
175 iso_pu_bacteria 2599185184 2599480609 272
176 iso_pu_bacteria 2932082852 2932085289 272

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04134

DCC1-like

DCC1-like thiol-disulfide oxidoreductase

9

115

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o3x-assembly1.cif.gz_A crystal structure of human gga1 gat domain 0.5583 133 213
3ctg-assembly1.cif.gz_A crystal structure of reduced glutaredoxin 2 0.4979 3 89
2kp2-assembly1.cif.gz_A solution structure of the b' domain of thermophilic fungal protein disulfide isomerase 0.4971 3 85
3c1s-assembly1.cif.gz_A crystal structure of grx1 in glutathionylated form 0.4964 3 89
2jad-assembly1.cif.gz_A yellow fluorescent protein - glutaredoxin fusion protein 0.4951 3 90
ID Description Score Start End Superfamily
af_Q9UJY5_210_314_1.20.58.160 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.5705 129 212 1.20.58.160
1zgmA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.5625 5 79 3.40.30.10
af_K7KG94_264_381_1.20.1310.10 Mainly Alpha;Up-down Bundle;5 helical Cullin repeat like;Cullin Repeats 0.5258 168 257 1.20.1310.10
af_I1M2D0_1_142_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5171 119 248 1.10.287.1490
2jadA02 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.4951 3 90 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3N7FHJ3-F1-model_v4 DUF393 domain-containing protein 0.9873 131 270 GO:0016020
AF-A0A4R2HF96-F1-model_v4 DoxX-like protein 0.9864 130 269 GO:0016020
AF-A0A385SHG9-F1-model_v4 DUF393 domain-containing protein 0.964 121 268 GO:0016020
AF-A0A2S6IPP8-F1-model_v4 Uncharacterized protein 0.9636 162 271 GO:0016020
AF-A0A4V1SR79-F1-model_v4 deleted 0.9546 133 268

Feature Viewer

pLDDT pTM Quality
80.75 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map