F266791
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 175 | 116 | 350 | 124 |
Family's Representative Sequence
| Representative Sequence | 3300042438|Ga0439459_0205359|Ga0439459_0205359_55_429 |
| Length | 113 |
| Sequence | VTDLNSLKYTAEHEWIAVDGDTATIGITAYAADKLGDVVYVDLPKVGASIASGKVVLFAPVDGEVVEANDAVVADPTLVNSDPYGAGWMIKVRFTGLPDGLLSADEYAAMTGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 2 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 3 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 10 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 11 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 12 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 13 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 14 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 15 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 16 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 17 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 18 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 19 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 20 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 21 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 22 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 23 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 24 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 27 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 28 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 29 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 30 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 31 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 32 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 33 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 34 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 35 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 36 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 37 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 38 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 39 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 40 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 41 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 42 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 43 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 44 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 45 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 46 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 47 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 48 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 49 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 50 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 51 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 52 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 53 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 54 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 55 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 56 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 57 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 58 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 59 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 60 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 61 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 62 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 63 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 64 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 65 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 66 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 67 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 68 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 69 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 70 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 71 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 72 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 73 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 74 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 75 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 76 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 77 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 78 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 79 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 80 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 81 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 82 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 83 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 84 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 85 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 86 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 87 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 88 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 89 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 90 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 91 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 92 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 93 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 94 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 95 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 96 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 97 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 98 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 99 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 100 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 101 | 2857737099 | Lysinimonas sp. R-73066 | Isolate | Unclassified |
| 102 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 103 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 104 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 105 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 106 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 107 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 108 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 109 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 110 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 111 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 112 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 113 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 114 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 115 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 116 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.71 |
| Metatranscriptomes | 1.14 |
| Isolates | 17.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 1.14 |
| Bulb | 0 |
| Endosphere | 12.57 |
| Nodule | 0 |
| Rhizoplane | 6.86 |
| Rhizosphere | 48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0439459_0205359 | 3300042438 | Bacteria | 540 |
| 2 | Ga0006562J51391_1025431 | 3300003578 | Bacteria | 1610 |
| 3 | Ga0065714_10013113 | 3300005288 | Bacteria | 2462 |
| 4 | Ga0065714_10497667 | 3300005288 | Bacteria | 525 |
| 5 | Ga0070675_101657016 | 3300005354 | Bacteria | 590 |
| 6 | Ga0070674_100814914 | 3300005356 | Bacteria | 807 |
| 7 | Ga0070674_101069021 | 3300005356 | Bacteria | 711 |
| 8 | Ga0070714_101558707 | 3300005435 | Bacteria | 645 |
| 9 | Ga0070672_100756323 | 3300005543 | Bacteria | 853 |
| 10 | Ga0070665_101310606 | 3300005548 | Bacteria | 734 |
| 11 | Ga0068862_100378439 | 3300005844 | Bacteria | 1320 |
| 12 | Ga0075365_10420375 | 3300006038 | Bacteria | 944 |
| 13 | Ga0075364_10473680 | 3300006051 | Bacteria | 856 |
| 14 | Ga0075367_10016747 | 3300006178 | Bacteria | 4007 |
| 15 | Ga0105244_10032545 | 3300009036 | Bacteria | 2759 |
| 16 | Ga0105244_10096341 | 3300009036 | Bacteria | 1451 |
| 17 | Ga0105243_10625566 | 3300009148 | Bacteria | 1040 |
| 18 | Ga0105243_10798041 | 3300009148 | Bacteria | 930 |
| 19 | Ga0105243_11933314 | 3300009148 | Bacteria | 623 |
| 20 | Ga0105239_11017358 | 3300010375 | Bacteria | 953 |
| 21 | Ga0157370_10677431 | 3300013104 | Bacteria | 942 |
| 22 | Ga0157369_10027730 | 3300013105 | Bacteria | 6274 |
| 23 | Ga0163163_10648160 | 3300014325 | Bacteria | 1120 |
| 24 | Ga0157380_10885928 | 3300014326 | Bacteria | 917 |
| 25 | Ga0207655_1020284 | 3300025728 | Bacteria | 3422 |
| 26 | Ga0207655_1027090 | 3300025728 | Bacteria | 2738 |
| 27 | Ga0207655_1150179 | 3300025728 | Bacteria | 738 |
| 28 | Ga0207664_11264902 | 3300025929 | Bacteria | 657 |
| 29 | Ga0207669_11191558 | 3300025937 | Bacteria | 645 |
| 30 | Ga0207691_10542896 | 3300025940 | Bacteria | 986 |
| 31 | Ga0207668_10876961 | 3300025972 | Bacteria | 798 |
| 32 | Ga0207675_100701543 | 3300026118 | Bacteria | 1021 |
| 33 | Ga0207675_100775549 | 3300026118 | Bacteria | 971 |
| 34 | Ga0307416_100896323 | 3300032002 | Bacteria | 987 |
| 35 | Ga0307415_100420993 | 3300032126 | Bacteria | 1146 |
| 36 | Ga0451789_0569532 | 3300041443 | Bacteria | 1217 |
| 37 | Ga0451789_0857531 | 3300041443 | Bacteria | 546 |
| 38 | Ga0451791_1151569 | 3300041451 | Bacteria | 1126 |
| 39 | Ga0451793_0170199 | 3300041452 | Bacteria | 3648 |
| 40 | Ga0451793_0836282 | 3300041452 | Bacteria | 580 |
| 41 | Ga0451797_0045325 | 3300041453 | Bacteria | 677 |
| 42 | Ga0451797_0658457 | 3300041453 | Bacteria | 694 |
| 43 | Ga0451795_0178147 | 3300041456 | Bacteria | 631 |
| 44 | Ga0451802_0394136 | 3300041460 | Bacteria | 767 |
| 45 | Ga0451853_1155618 | 3300041512 | Bacteria | 1165 |
| 46 | Ga0439462_0071184 | 3300042015 | Bacteria | 944 |
| 47 | Ga0466965_0000001 | 3300044683 | Bacteria | 317826 |
| 48 | Ga0466970_0253978 | 3300044765 | Bacteria | 985 |
| 49 | Ga0466957_0581196 | 3300044842 | Bacteria | 783 |
| 50 | Ga0466959_0262063 | 3300045049 | Bacteria | 1190 |
| 51 | Ga0466958_0368408 | 3300045836 | Bacteria | 926 |
| 52 | Ga0466967_0623417 | 3300045976 | Bacteria | 1065 |
| 53 | Ga0495590_0000623 | 3300046457 | Bacteria | 16489 |
| 54 | Ga0495620_0046950 | 3300046515 | Bacteria | 1862 |
| 55 | Ga0495654_0106517 | 3300046530 | Bacteria | 1283 |
| 56 | Ga0495656_0050776 | 3300046615 | Bacteria | 1772 |
| 57 | Ga0495671_0063054 | 3300046692 | Bacteria | 1826 |
| 58 | Ga0495649_0368568 | 3300046694 | Bacteria | 724 |
| 59 | Ga0495589_0256053 | 3300046794 | Bacteria | 817 |
| 60 | Ga0495672_0094239 | 3300047320 | Bacteria | 1637 |
| 61 | Ga0495672_0098352 | 3300047320 | Bacteria | 1592 |
| 62 | Ga0495686_0139890 | 3300047472 | Bacteria | 1429 |
| 63 | Ga0495615_0042445 | 3300048090 | Bacteria | 1141 |
| 64 | Ga0496108_0660852 | 3300048911 | Bacteria | 908 |
| 65 | Ga0496111_0206112 | 3300048914 | Bacteria | 1461 |
| 66 | Ga0496114_0532160 | 3300048917 | Bacteria | 1039 |
| 67 | Ga0496117_0000063 | 3300048920 | Bacteria | 254446 |
| 68 | Ga0496117_0011709 | 3300048920 | Bacteria | 7823 |
| 69 | Ga0496117_0012311 | 3300048920 | Bacteria | 7561 |
| 70 | Ga0496117_0338739 | 3300048920 | Bacteria | 781 |
| 71 | Ga0496118_0049301 | 3300048921 | Bacteria | 3244 |
| 72 | Ga0496118_0085652 | 3300048921 | Bacteria | 2193 |
| 73 | Ga0496118_0141164 | 3300048921 | Bacteria | 1527 |
| 74 | Ga0496118_0522264 | 3300048921 | Bacteria | 585 |
| 75 | Ga0496119_0006865 | 3300048922 | Bacteria | 10403 |
| 76 | Ga0496119_0028123 | 3300048922 | Bacteria | 3845 |
| 77 | Ga0496119_0058845 | 3300048922 | Bacteria | 2312 |
| 78 | Ga0496120_0000717 | 3300048923 | Bacteria | 48597 |
| 79 | Ga0496120_0149797 | 3300048923 | Bacteria | 1174 |
| 80 | Ga0496122_0000036 | 3300048925 | Bacteria | 312598 |
| 81 | Ga0496122_0018717 | 3300048925 | Bacteria | 6375 |
| 82 | Ga0496122_0020089 | 3300048925 | Bacteria | 6064 |
| 83 | Ga0496122_0449327 | 3300048925 | Bacteria | 640 |
| 84 | Ga0496123_0000011 | 3300048926 | Bacteria | 493925 |
| 85 | Ga0496123_0011622 | 3300048926 | Bacteria | 7601 |
| 86 | Ga0496123_0067850 | 3300048926 | Bacteria | 2250 |
| 87 | Ga0496123_0234075 | 3300048926 | Bacteria | 917 |
| 88 | Ga0496124_0001451 | 3300048927 | Bacteria | 34959 |
| 89 | Ga0496124_0020196 | 3300048927 | Bacteria | 6165 |
| 90 | Ga0496124_0063782 | 3300048927 | Bacteria | 3077 |
| 91 | Ga0496124_0453406 | 3300048927 | Bacteria | 874 |
| 92 | Ga0496125_0004725 | 3300048928 | Bacteria | 15520 |
| 93 | Ga0496125_0026851 | 3300048928 | Bacteria | 5231 |
| 94 | Ga0496125_0088482 | 3300048928 | Bacteria | 2334 |
| 95 | Ga0496126_0015008 | 3300048929 | Bacteria | 7809 |
| 96 | Ga0496126_0021309 | 3300048929 | Bacteria | 6331 |
| 97 | Ga0496126_0082939 | 3300048929 | Bacteria | 2830 |
| 98 | Ga0496126_0208791 | 3300048929 | Bacteria | 1645 |
| 99 | Ga0496126_0402804 | 3300048929 | Bacteria | 1109 |
| 100 | Ga0501031_0122271 | 3300049568 | Bacteria | 1700 |
| 101 | Ga0501032_0044652 | 3300049569 | Bacteria | 2999 |
| 102 | Ga0501032_0335078 | 3300049569 | Bacteria | 975 |
| 103 | Ga0501033_0017085 | 3300049570 | Bacteria | 5484 |
| 104 | Ga0501033_0103326 | 3300049570 | Bacteria | 2078 |
| 105 | Ga0501034_0024086 | 3300049571 | Bacteria | 6194 |
| 106 | Ga0501034_0050176 | 3300049571 | Bacteria | 4209 |
| 107 | Ga0501034_0055895 | 3300049571 | Bacteria | 3972 |
| 108 | Ga0501034_0079846 | 3300049571 | Bacteria | 3275 |
| 109 | Ga0501034_0207270 | 3300049571 | Bacteria | 1916 |
| 110 | Ga0501034_0577304 | 3300049571 | Bacteria | 1032 |
| 111 | Ga0501034_0902258 | 3300049571 | Bacteria | 771 |
| 112 | Ga0501034_0903830 | 3300049571 | Bacteria | 771 |
| 113 | Ga0501036_0019407 | 3300049572 | Bacteria | 5707 |
| 114 | Ga0501037_0039004 | 3300049573 | Bacteria | 3498 |
| 115 | Ga0501037_0404112 | 3300049573 | Bacteria | 936 |
| 116 | Ga0501038_0018839 | 3300049574 | Bacteria | 6231 |
| 117 | Ga0501038_0034660 | 3300049574 | Bacteria | 4437 |
| 118 | Ga0501038_0080565 | 3300049574 | Bacteria | 2744 |
| 119 | Ga0501039_0069624 | 3300049575 | Bacteria | 2733 |
| 120 | Ga0501043_0029833 | 3300049579 | Bacteria | 4285 |
| 121 | Ga0501068_0218767 | 3300049584 | Bacteria | 1210 |
| 122 | Ga0501071_1215479 | 3300049587 | Bacteria | 582 |
| 123 | Ga0501073_0129672 | 3300049589 | Bacteria | 1748 |
| 124 | Ga0501073_0748957 | 3300049589 | Bacteria | 674 |
| 125 | Ga0501044_0667927 | 3300049823 | Bacteria | 927 |
| 126 | nmdc:mga03n38_117094_c1 | 3300050490 | Bacteria | 1305 |
| 127 | nmdc:mga03n38_163533_c1 | 3300050490 | Bacteria | 1128 |
| 128 | nmdc:mga00v17_58772_c1 | 3300050491 | Bacteria | 2357 |
| 129 | nmdc:mga0yw44_334760_c1 | 3300050492 | Bacteria | 1018 |
| 130 | nmdc:mga06z11_35611_c1 | 3300050494 | Bacteria | 2452 |
| 131 | Ga0500651_0526681 | 3300053093 | Bacteria | 649 |
| 132 | Ga0500559_0002055 | 3300053136 | Bacteria | 10774 |
| 133 | Ga0500559_0003280 | 3300053136 | Bacteria | 8027 |
| 134 | Ga0500559_0046486 | 3300053136 | Bacteria | 1904 |
| 135 | Ga0500559_0264692 | 3300053136 | Bacteria | 809 |
| 136 | Ga0500568_0001019 | 3300053139 | Bacteria | 19182 |
| 137 | Ga0500573_0000018 | 3300053140 | Bacteria | 177945 |
| 138 | Ga0500573_0069610 | 3300053140 | Bacteria | 2008 |
| 139 | Ga0500573_0081893 | 3300053140 | Bacteria | 1833 |
| 140 | Ga0500573_0132670 | 3300053140 | Bacteria | 1378 |
| 141 | Ga0500573_0390483 | 3300053140 | Bacteria | 662 |
| 142 | Ga0500573_0395117 | 3300053140 | Bacteria | 656 |
| 143 | Ga0500573_0529802 | 3300053140 | Bacteria | 526 |
| 144 | Ga0500577_0270083 | 3300053142 | Bacteria | 740 |
| 145 | Ga0587084_013890 | 3300059477 | Bacteria | 1114 |
| 146 | 2643875833 | 2643221572 | Bacteria | 3614809 |
| 147 | 2643885931 | 2643221575 | Bacteria | 4022601 |
| 148 | 2643995489 | 2643221597 | Bacteria | 3347721 |
| 149 | 2644182845 | 2643221632 | Bacteria | 3406696 |
| 150 | 2644198677 | 2643221635 | Bacteria | 2632343 |
| 151 | 2644382888 | 2643221669 | Bacteria | 3611286 |
| 152 | 2758226518 | 2757320536 | Bacteria | 3629334 |
| 153 | 2774384111 | 2773857759 | Bacteria | 2963774 |
| 154 | 2808630800 | 2808606306 | Bacteria | 3608896 |
| 155 | 2821270408 | 2821268502 | Bacteria | 3750023 |
| 156 | 2833711376 | 2833709550 | Bacteria | 4008291 |
| 157 | 2852644868 | 2852643534 | Bacteria | 3013378 |
| 158 | 2857721979 | 2857720070 | Bacteria | 3189373 |
| 159 | 2857730339 | 2857729791 | Bacteria | 4040535 |
| 160 | 2857738149 | 2857737099 | Bacteria | 3104305 |
| 161 | 2870622798 | 2870622029 | Bacteria | 3643329 |
| 162 | 2895663654 | 2895660088 | Bacteria | 3782833 |
| 163 | 2904511609 | 2904509784 | Bacteria | 3520416 |
| 164 | 2928091761 | 2928090899 | Bacteria | 3158267 |
| 165 | 2928123554 | 2928121344 | Bacteria | 3972376 |
| 166 | 2939662242 | 2939660829 | Bacteria | 3784848 |
| 167 | 2974297568 | 2974294766 | Bacteria | 3767688 |
| 168 | 2974326196 | 2974324384 | Bacteria | 3750535 |
| 169 | 2977231801 | 2977228692 | Bacteria | 3450105 |
| 170 | 2977237159 | 2977236895 | Bacteria | 3569373 |
| 171 | 2977254376 | 2977251589 | Bacteria | 2952848 |
| 172 | 2977267111 | 2977264416 | Bacteria | 3750737 |
| 173 | 2984545052 | 2984542743 | Bacteria | 3569378 |
| 174 | 2984581479 | 2984580707 | Bacteria | 3351387 |
| 175 | 8016257166 | 8016254467 | Bacteria | 3797036 |
| 176 | Ga0439459_0205359 | |||
| 177 | Ga0006562J51391_1025431 | |||
| 178 | Ga0065714_10013113 | |||
| 179 | Ga0065714_10497667 | |||
| 180 | Ga0070675_101657016 | |||
| 181 | Ga0070674_100814914 | |||
| 182 | Ga0070674_101069021 | |||
| 183 | Ga0070714_101558707 | |||
| 184 | Ga0070672_100756323 | |||
| 185 | Ga0070665_101310606 | |||
| 186 | Ga0068862_100378439 | |||
| 187 | Ga0075365_10420375 | |||
| 188 | Ga0075364_10473680 | |||
| 189 | Ga0075367_10016747 | |||
| 190 | Ga0105244_10032545 | |||
| 191 | Ga0105244_10096341 | |||
| 192 | Ga0105243_10625566 | |||
| 193 | Ga0105243_10798041 | |||
| 194 | Ga0105243_11933314 | |||
| 195 | Ga0105239_11017358 | |||
| 196 | Ga0157370_10677431 | |||
| 197 | Ga0157369_10027730 | |||
| 198 | Ga0163163_10648160 | |||
| 199 | Ga0157380_10885928 | |||
| 200 | Ga0207655_1020284 | |||
| 201 | Ga0207655_1027090 | |||
| 202 | Ga0207655_1150179 | |||
| 203 | Ga0207664_11264902 | |||
| 204 | Ga0207669_11191558 | |||
| 205 | Ga0207691_10542896 | |||
| 206 | Ga0207668_10876961 | |||
| 207 | Ga0207675_100701543 | |||
| 208 | Ga0207675_100775549 | |||
| 209 | Ga0307416_100896323 | |||
| 210 | Ga0307415_100420993 | |||
| 211 | Ga0451789_0569532 | |||
| 212 | Ga0451789_0857531 | |||
| 213 | Ga0451791_1151569 | |||
| 214 | Ga0451793_0170199 | |||
| 215 | Ga0451793_0836282 | |||
| 216 | Ga0451797_0045325 | |||
| 217 | Ga0451797_0658457 | |||
| 218 | Ga0451795_0178147 | |||
| 219 | Ga0451802_0394136 | |||
| 220 | Ga0451853_1155618 | |||
| 221 | Ga0439462_0071184 | |||
| 222 | Ga0466965_0000001 | |||
| 223 | Ga0466970_0253978 | |||
| 224 | Ga0466957_0581196 | |||
| 225 | Ga0466959_0262063 | |||
| 226 | Ga0466958_0368408 | |||
| 227 | Ga0466967_0623417 | |||
| 228 | Ga0495590_0000623 | |||
| 229 | Ga0495620_0046950 | |||
| 230 | Ga0495654_0106517 | |||
| 231 | Ga0495656_0050776 | |||
| 232 | Ga0495671_0063054 | |||
| 233 | Ga0495649_0368568 | |||
| 234 | Ga0495589_0256053 | |||
| 235 | Ga0495672_0094239 | |||
| 236 | Ga0495672_0098352 | |||
| 237 | Ga0495686_0139890 | |||
| 238 | Ga0495615_0042445 | |||
| 239 | Ga0496108_0660852 | |||
| 240 | Ga0496111_0206112 | |||
| 241 | Ga0496114_0532160 | |||
| 242 | Ga0496117_0000063 | |||
| 243 | Ga0496117_0011709 | |||
| 244 | Ga0496117_0012311 | |||
| 245 | Ga0496117_0338739 | |||
| 246 | Ga0496118_0049301 | |||
| 247 | Ga0496118_0085652 | |||
| 248 | Ga0496118_0141164 | |||
| 249 | Ga0496118_0522264 | |||
| 250 | Ga0496119_0006865 | |||
| 251 | Ga0496119_0028123 | |||
| 252 | Ga0496119_0058845 | |||
| 253 | Ga0496120_0000717 | |||
| 254 | Ga0496120_0149797 | |||
| 255 | Ga0496122_0000036 | |||
| 256 | Ga0496122_0018717 | |||
| 257 | Ga0496122_0020089 | |||
| 258 | Ga0496122_0449327 | |||
| 259 | Ga0496123_0000011 | |||
| 260 | Ga0496123_0011622 | |||
| 261 | Ga0496123_0067850 | |||
| 262 | Ga0496123_0234075 | |||
| 263 | Ga0496124_0001451 | |||
| 264 | Ga0496124_0020196 | |||
| 265 | Ga0496124_0063782 | |||
| 266 | Ga0496124_0453406 | |||
| 267 | Ga0496125_0004725 | |||
| 268 | Ga0496125_0026851 | |||
| 269 | Ga0496125_0088482 | |||
| 270 | Ga0496126_0015008 | |||
| 271 | Ga0496126_0021309 | |||
| 272 | Ga0496126_0082939 | |||
| 273 | Ga0496126_0208791 | |||
| 274 | Ga0496126_0402804 | |||
| 275 | Ga0501031_0122271 | |||
| 276 | Ga0501032_0044652 | |||
| 277 | Ga0501032_0335078 | |||
| 278 | Ga0501033_0017085 | |||
| 279 | Ga0501033_0103326 | |||
| 280 | Ga0501034_0024086 | |||
| 281 | Ga0501034_0050176 | |||
| 282 | Ga0501034_0055895 | |||
| 283 | Ga0501034_0079846 | |||
| 284 | Ga0501034_0207270 | |||
| 285 | Ga0501034_0577304 | |||
| 286 | Ga0501034_0902258 | |||
| 287 | Ga0501034_0903830 | |||
| 288 | Ga0501036_0019407 | |||
| 289 | Ga0501037_0039004 | |||
| 290 | Ga0501037_0404112 | |||
| 291 | Ga0501038_0018839 | |||
| 292 | Ga0501038_0034660 | |||
| 293 | Ga0501038_0080565 | |||
| 294 | Ga0501039_0069624 | |||
| 295 | Ga0501043_0029833 | |||
| 296 | Ga0501068_0218767 | |||
| 297 | Ga0501071_1215479 | |||
| 298 | Ga0501073_0129672 | |||
| 299 | Ga0501073_0748957 | |||
| 300 | Ga0501044_0667927 | |||
| 301 | nmdc:mga03n38_117094_c1 | |||
| 302 | nmdc:mga03n38_163533_c1 | |||
| 303 | nmdc:mga00v17_58772_c1 | |||
| 304 | nmdc:mga0yw44_334760_c1 | |||
| 305 | nmdc:mga06z11_35611_c1 | |||
| 306 | Ga0500651_0526681 | |||
| 307 | Ga0500559_0002055 | |||
| 308 | Ga0500559_0003280 | |||
| 309 | Ga0500559_0046486 | |||
| 310 | Ga0500559_0264692 | |||
| 311 | Ga0500568_0001019 | |||
| 312 | Ga0500573_0000018 | |||
| 313 | Ga0500573_0069610 | |||
| 314 | Ga0500573_0081893 | |||
| 315 | Ga0500573_0132670 | |||
| 316 | Ga0500573_0390483 | |||
| 317 | Ga0500573_0395117 | |||
| 318 | Ga0500573_0529802 | |||
| 319 | Ga0500577_0270083 | |||
| 320 | Ga0587084_013890 | |||
| 321 | 2643875833 | |||
| 322 | 2643885931 | |||
| 323 | 2643995489 | |||
| 324 | 2644182845 | |||
| 325 | 2644198677 | |||
| 326 | 2644382888 | |||
| 327 | 2758226518 | |||
| 328 | 2774384111 | |||
| 329 | 2808630800 | |||
| 330 | 2821270408 | |||
| 331 | 2833711376 | |||
| 332 | 2852644868 | |||
| 333 | 2857721979 | |||
| 334 | 2857730339 | |||
| 335 | 2857738149 | |||
| 336 | 2870622798 | |||
| 337 | 2895663654 | |||
| 338 | 2904511609 | |||
| 339 | 2928091761 | |||
| 340 | 2928123554 | |||
| 341 | 2939662242 | |||
| 342 | 2974297568 | |||
| 343 | 2974326196 | |||
| 344 | 2977231801 | |||
| 345 | 2977237159 | |||
| 346 | 2977254376 | |||
| 347 | 2977267111 | |||
| 348 | 2984545052 | |||
| 349 | 2984581479 | |||
| 350 | 8016257166 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3wdn-assembly1.cif.gz_A | high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method | 0.9713 | 6 | 124 |
| 1onl-assembly3.cif.gz_C | crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system | 0.9592 | 5 | 127 |
| 3mxu-assembly1.cif.gz_A | crystal structure of glycine cleavage system protein h from bartonella henselae | 0.955 | 7 | 106 |
| 3a8k-assembly1.cif.gz_E | crystal structure of etd97n-ehred complex | 0.9483 | 5 | 124 |
| 2ka7-assembly1.cif.gz_A | nmr solution structure of tm0212 at 40 c | 0.9478 | 7 | 126 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3wdnA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9698 | 6 | 124 | 2.40.50.100 |
| af_Q54JV8_6_144_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9639 | 6 | 123 | 2.40.50.100 |
| af_Q20634_6_139_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9633 | 3 | 122 | 2.40.50.100 |
| af_A4IC11_1_107_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9572 | 20 | 123 | 2.40.50.100 |
| af_Q4E4F5_6_138_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9551 | 3 | 123 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S3GD37-F1-model_v4 | Glycine cleavage system H protein | 0.9962 | 7 | 105 |
GO:0005739
GO:0005960 GO:0019464 |
| AF-A0A0S4QVH0-F1-model_v4 | Glycine cleavage system H protein | 0.9961 | 5 | 124 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A7Y9ESB0-F1-model_v4 | Glycine cleavage system H protein | 0.9942 | 1 | 125 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A2U2DT81-F1-model_v4 | Glycine cleavage system H protein | 0.9922 | 7 | 123 |
GO:0005737
GO:0005960 GO:0019464 |
| AF-A0A258KWQ2-F1-model_v4 | Glycine cleavage system H protein | 0.9918 | 7 | 123 |
GO:0005737
GO:0005960 GO:0019464 |