F266791

General Info

Members Datasets Scaffolds Average Seq Length
175 116 350 124

Family's Representative Sequence

Representative Sequence 3300042438|Ga0439459_0205359|Ga0439459_0205359_55_429
Length 113
Sequence VTDLNSLKYTAEHEWIAVDGDTATIGITAYAADKLGDVVYVDLPKVGASIASGKVVLFAPVDGEVVEANDAVVADPTLVNSDPYGAGWMIKVRFTGLPDGLLSADEYAAMTGE

Samples

Sample ID Description Type Environment
1 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
10 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
11 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
12 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
13 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
14 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
15 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
16 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
17 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
18 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
19 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
20 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
27 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
28 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
29 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
30 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
31 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
32 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
33 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
34 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
35 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
36 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
37 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
38 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
39 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
40 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
41 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
42 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
43 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
44 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
45 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
46 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
47 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
48 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
49 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
50 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
51 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
52 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
53 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
54 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
55 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
56 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
57 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
58 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
59 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
60 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
61 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
62 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
63 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
64 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
74 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
75 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
76 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
77 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
78 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
79 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
80 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
81 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
82 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
83 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
84 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
85 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
86 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 2643221572 Leifsonia sp. Root60 Isolate Unclassified
88 2643221575 Microbacterium sp. Root61 Isolate Unclassified
89 2643221597 Microbacterium sp. Root180 Isolate Unclassified
90 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
91 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
92 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
93 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
94 2773857759 Microbacterium sp. 1294 Isolate Unclassified
95 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
96 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
97 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
98 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
99 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
100 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
101 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
102 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
103 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
104 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
105 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
106 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
107 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
108 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
109 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
110 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
111 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
112 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
113 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
114 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
115 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
116 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.71
Metatranscriptomes 1.14
Isolates 17.14

Biome Distribution

Category Percentage (%)
Aerial Root 1.14
Bulb 0
Endosphere 12.57
Nodule 0
Rhizoplane 6.86
Rhizosphere 48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439459_0205359 3300042438 Bacteria 540
2 Ga0006562J51391_1025431 3300003578 Bacteria 1610
3 Ga0065714_10013113 3300005288 Bacteria 2462
4 Ga0065714_10497667 3300005288 Bacteria 525
5 Ga0070675_101657016 3300005354 Bacteria 590
6 Ga0070674_100814914 3300005356 Bacteria 807
7 Ga0070674_101069021 3300005356 Bacteria 711
8 Ga0070714_101558707 3300005435 Bacteria 645
9 Ga0070672_100756323 3300005543 Bacteria 853
10 Ga0070665_101310606 3300005548 Bacteria 734
11 Ga0068862_100378439 3300005844 Bacteria 1320
12 Ga0075365_10420375 3300006038 Bacteria 944
13 Ga0075364_10473680 3300006051 Bacteria 856
14 Ga0075367_10016747 3300006178 Bacteria 4007
15 Ga0105244_10032545 3300009036 Bacteria 2759
16 Ga0105244_10096341 3300009036 Bacteria 1451
17 Ga0105243_10625566 3300009148 Bacteria 1040
18 Ga0105243_10798041 3300009148 Bacteria 930
19 Ga0105243_11933314 3300009148 Bacteria 623
20 Ga0105239_11017358 3300010375 Bacteria 953
21 Ga0157370_10677431 3300013104 Bacteria 942
22 Ga0157369_10027730 3300013105 Bacteria 6274
23 Ga0163163_10648160 3300014325 Bacteria 1120
24 Ga0157380_10885928 3300014326 Bacteria 917
25 Ga0207655_1020284 3300025728 Bacteria 3422
26 Ga0207655_1027090 3300025728 Bacteria 2738
27 Ga0207655_1150179 3300025728 Bacteria 738
28 Ga0207664_11264902 3300025929 Bacteria 657
29 Ga0207669_11191558 3300025937 Bacteria 645
30 Ga0207691_10542896 3300025940 Bacteria 986
31 Ga0207668_10876961 3300025972 Bacteria 798
32 Ga0207675_100701543 3300026118 Bacteria 1021
33 Ga0207675_100775549 3300026118 Bacteria 971
34 Ga0307416_100896323 3300032002 Bacteria 987
35 Ga0307415_100420993 3300032126 Bacteria 1146
36 Ga0451789_0569532 3300041443 Bacteria 1217
37 Ga0451789_0857531 3300041443 Bacteria 546
38 Ga0451791_1151569 3300041451 Bacteria 1126
39 Ga0451793_0170199 3300041452 Bacteria 3648
40 Ga0451793_0836282 3300041452 Bacteria 580
41 Ga0451797_0045325 3300041453 Bacteria 677
42 Ga0451797_0658457 3300041453 Bacteria 694
43 Ga0451795_0178147 3300041456 Bacteria 631
44 Ga0451802_0394136 3300041460 Bacteria 767
45 Ga0451853_1155618 3300041512 Bacteria 1165
46 Ga0439462_0071184 3300042015 Bacteria 944
47 Ga0466965_0000001 3300044683 Bacteria 317826
48 Ga0466970_0253978 3300044765 Bacteria 985
49 Ga0466957_0581196 3300044842 Bacteria 783
50 Ga0466959_0262063 3300045049 Bacteria 1190
51 Ga0466958_0368408 3300045836 Bacteria 926
52 Ga0466967_0623417 3300045976 Bacteria 1065
53 Ga0495590_0000623 3300046457 Bacteria 16489
54 Ga0495620_0046950 3300046515 Bacteria 1862
55 Ga0495654_0106517 3300046530 Bacteria 1283
56 Ga0495656_0050776 3300046615 Bacteria 1772
57 Ga0495671_0063054 3300046692 Bacteria 1826
58 Ga0495649_0368568 3300046694 Bacteria 724
59 Ga0495589_0256053 3300046794 Bacteria 817
60 Ga0495672_0094239 3300047320 Bacteria 1637
61 Ga0495672_0098352 3300047320 Bacteria 1592
62 Ga0495686_0139890 3300047472 Bacteria 1429
63 Ga0495615_0042445 3300048090 Bacteria 1141
64 Ga0496108_0660852 3300048911 Bacteria 908
65 Ga0496111_0206112 3300048914 Bacteria 1461
66 Ga0496114_0532160 3300048917 Bacteria 1039
67 Ga0496117_0000063 3300048920 Bacteria 254446
68 Ga0496117_0011709 3300048920 Bacteria 7823
69 Ga0496117_0012311 3300048920 Bacteria 7561
70 Ga0496117_0338739 3300048920 Bacteria 781
71 Ga0496118_0049301 3300048921 Bacteria 3244
72 Ga0496118_0085652 3300048921 Bacteria 2193
73 Ga0496118_0141164 3300048921 Bacteria 1527
74 Ga0496118_0522264 3300048921 Bacteria 585
75 Ga0496119_0006865 3300048922 Bacteria 10403
76 Ga0496119_0028123 3300048922 Bacteria 3845
77 Ga0496119_0058845 3300048922 Bacteria 2312
78 Ga0496120_0000717 3300048923 Bacteria 48597
79 Ga0496120_0149797 3300048923 Bacteria 1174
80 Ga0496122_0000036 3300048925 Bacteria 312598
81 Ga0496122_0018717 3300048925 Bacteria 6375
82 Ga0496122_0020089 3300048925 Bacteria 6064
83 Ga0496122_0449327 3300048925 Bacteria 640
84 Ga0496123_0000011 3300048926 Bacteria 493925
85 Ga0496123_0011622 3300048926 Bacteria 7601
86 Ga0496123_0067850 3300048926 Bacteria 2250
87 Ga0496123_0234075 3300048926 Bacteria 917
88 Ga0496124_0001451 3300048927 Bacteria 34959
89 Ga0496124_0020196 3300048927 Bacteria 6165
90 Ga0496124_0063782 3300048927 Bacteria 3077
91 Ga0496124_0453406 3300048927 Bacteria 874
92 Ga0496125_0004725 3300048928 Bacteria 15520
93 Ga0496125_0026851 3300048928 Bacteria 5231
94 Ga0496125_0088482 3300048928 Bacteria 2334
95 Ga0496126_0015008 3300048929 Bacteria 7809
96 Ga0496126_0021309 3300048929 Bacteria 6331
97 Ga0496126_0082939 3300048929 Bacteria 2830
98 Ga0496126_0208791 3300048929 Bacteria 1645
99 Ga0496126_0402804 3300048929 Bacteria 1109
100 Ga0501031_0122271 3300049568 Bacteria 1700
101 Ga0501032_0044652 3300049569 Bacteria 2999
102 Ga0501032_0335078 3300049569 Bacteria 975
103 Ga0501033_0017085 3300049570 Bacteria 5484
104 Ga0501033_0103326 3300049570 Bacteria 2078
105 Ga0501034_0024086 3300049571 Bacteria 6194
106 Ga0501034_0050176 3300049571 Bacteria 4209
107 Ga0501034_0055895 3300049571 Bacteria 3972
108 Ga0501034_0079846 3300049571 Bacteria 3275
109 Ga0501034_0207270 3300049571 Bacteria 1916
110 Ga0501034_0577304 3300049571 Bacteria 1032
111 Ga0501034_0902258 3300049571 Bacteria 771
112 Ga0501034_0903830 3300049571 Bacteria 771
113 Ga0501036_0019407 3300049572 Bacteria 5707
114 Ga0501037_0039004 3300049573 Bacteria 3498
115 Ga0501037_0404112 3300049573 Bacteria 936
116 Ga0501038_0018839 3300049574 Bacteria 6231
117 Ga0501038_0034660 3300049574 Bacteria 4437
118 Ga0501038_0080565 3300049574 Bacteria 2744
119 Ga0501039_0069624 3300049575 Bacteria 2733
120 Ga0501043_0029833 3300049579 Bacteria 4285
121 Ga0501068_0218767 3300049584 Bacteria 1210
122 Ga0501071_1215479 3300049587 Bacteria 582
123 Ga0501073_0129672 3300049589 Bacteria 1748
124 Ga0501073_0748957 3300049589 Bacteria 674
125 Ga0501044_0667927 3300049823 Bacteria 927
126 nmdc:mga03n38_117094_c1 3300050490 Bacteria 1305
127 nmdc:mga03n38_163533_c1 3300050490 Bacteria 1128
128 nmdc:mga00v17_58772_c1 3300050491 Bacteria 2357
129 nmdc:mga0yw44_334760_c1 3300050492 Bacteria 1018
130 nmdc:mga06z11_35611_c1 3300050494 Bacteria 2452
131 Ga0500651_0526681 3300053093 Bacteria 649
132 Ga0500559_0002055 3300053136 Bacteria 10774
133 Ga0500559_0003280 3300053136 Bacteria 8027
134 Ga0500559_0046486 3300053136 Bacteria 1904
135 Ga0500559_0264692 3300053136 Bacteria 809
136 Ga0500568_0001019 3300053139 Bacteria 19182
137 Ga0500573_0000018 3300053140 Bacteria 177945
138 Ga0500573_0069610 3300053140 Bacteria 2008
139 Ga0500573_0081893 3300053140 Bacteria 1833
140 Ga0500573_0132670 3300053140 Bacteria 1378
141 Ga0500573_0390483 3300053140 Bacteria 662
142 Ga0500573_0395117 3300053140 Bacteria 656
143 Ga0500573_0529802 3300053140 Bacteria 526
144 Ga0500577_0270083 3300053142 Bacteria 740
145 Ga0587084_013890 3300059477 Bacteria 1114
146 2643875833 2643221572 Bacteria 3614809
147 2643885931 2643221575 Bacteria 4022601
148 2643995489 2643221597 Bacteria 3347721
149 2644182845 2643221632 Bacteria 3406696
150 2644198677 2643221635 Bacteria 2632343
151 2644382888 2643221669 Bacteria 3611286
152 2758226518 2757320536 Bacteria 3629334
153 2774384111 2773857759 Bacteria 2963774
154 2808630800 2808606306 Bacteria 3608896
155 2821270408 2821268502 Bacteria 3750023
156 2833711376 2833709550 Bacteria 4008291
157 2852644868 2852643534 Bacteria 3013378
158 2857721979 2857720070 Bacteria 3189373
159 2857730339 2857729791 Bacteria 4040535
160 2857738149 2857737099 Bacteria 3104305
161 2870622798 2870622029 Bacteria 3643329
162 2895663654 2895660088 Bacteria 3782833
163 2904511609 2904509784 Bacteria 3520416
164 2928091761 2928090899 Bacteria 3158267
165 2928123554 2928121344 Bacteria 3972376
166 2939662242 2939660829 Bacteria 3784848
167 2974297568 2974294766 Bacteria 3767688
168 2974326196 2974324384 Bacteria 3750535
169 2977231801 2977228692 Bacteria 3450105
170 2977237159 2977236895 Bacteria 3569373
171 2977254376 2977251589 Bacteria 2952848
172 2977267111 2977264416 Bacteria 3750737
173 2984545052 2984542743 Bacteria 3569378
174 2984581479 2984580707 Bacteria 3351387
175 8016257166 8016254467 Bacteria 3797036
176 Ga0439459_0205359
177 Ga0006562J51391_1025431
178 Ga0065714_10013113
179 Ga0065714_10497667
180 Ga0070675_101657016
181 Ga0070674_100814914
182 Ga0070674_101069021
183 Ga0070714_101558707
184 Ga0070672_100756323
185 Ga0070665_101310606
186 Ga0068862_100378439
187 Ga0075365_10420375
188 Ga0075364_10473680
189 Ga0075367_10016747
190 Ga0105244_10032545
191 Ga0105244_10096341
192 Ga0105243_10625566
193 Ga0105243_10798041
194 Ga0105243_11933314
195 Ga0105239_11017358
196 Ga0157370_10677431
197 Ga0157369_10027730
198 Ga0163163_10648160
199 Ga0157380_10885928
200 Ga0207655_1020284
201 Ga0207655_1027090
202 Ga0207655_1150179
203 Ga0207664_11264902
204 Ga0207669_11191558
205 Ga0207691_10542896
206 Ga0207668_10876961
207 Ga0207675_100701543
208 Ga0207675_100775549
209 Ga0307416_100896323
210 Ga0307415_100420993
211 Ga0451789_0569532
212 Ga0451789_0857531
213 Ga0451791_1151569
214 Ga0451793_0170199
215 Ga0451793_0836282
216 Ga0451797_0045325
217 Ga0451797_0658457
218 Ga0451795_0178147
219 Ga0451802_0394136
220 Ga0451853_1155618
221 Ga0439462_0071184
222 Ga0466965_0000001
223 Ga0466970_0253978
224 Ga0466957_0581196
225 Ga0466959_0262063
226 Ga0466958_0368408
227 Ga0466967_0623417
228 Ga0495590_0000623
229 Ga0495620_0046950
230 Ga0495654_0106517
231 Ga0495656_0050776
232 Ga0495671_0063054
233 Ga0495649_0368568
234 Ga0495589_0256053
235 Ga0495672_0094239
236 Ga0495672_0098352
237 Ga0495686_0139890
238 Ga0495615_0042445
239 Ga0496108_0660852
240 Ga0496111_0206112
241 Ga0496114_0532160
242 Ga0496117_0000063
243 Ga0496117_0011709
244 Ga0496117_0012311
245 Ga0496117_0338739
246 Ga0496118_0049301
247 Ga0496118_0085652
248 Ga0496118_0141164
249 Ga0496118_0522264
250 Ga0496119_0006865
251 Ga0496119_0028123
252 Ga0496119_0058845
253 Ga0496120_0000717
254 Ga0496120_0149797
255 Ga0496122_0000036
256 Ga0496122_0018717
257 Ga0496122_0020089
258 Ga0496122_0449327
259 Ga0496123_0000011
260 Ga0496123_0011622
261 Ga0496123_0067850
262 Ga0496123_0234075
263 Ga0496124_0001451
264 Ga0496124_0020196
265 Ga0496124_0063782
266 Ga0496124_0453406
267 Ga0496125_0004725
268 Ga0496125_0026851
269 Ga0496125_0088482
270 Ga0496126_0015008
271 Ga0496126_0021309
272 Ga0496126_0082939
273 Ga0496126_0208791
274 Ga0496126_0402804
275 Ga0501031_0122271
276 Ga0501032_0044652
277 Ga0501032_0335078
278 Ga0501033_0017085
279 Ga0501033_0103326
280 Ga0501034_0024086
281 Ga0501034_0050176
282 Ga0501034_0055895
283 Ga0501034_0079846
284 Ga0501034_0207270
285 Ga0501034_0577304
286 Ga0501034_0902258
287 Ga0501034_0903830
288 Ga0501036_0019407
289 Ga0501037_0039004
290 Ga0501037_0404112
291 Ga0501038_0018839
292 Ga0501038_0034660
293 Ga0501038_0080565
294 Ga0501039_0069624
295 Ga0501043_0029833
296 Ga0501068_0218767
297 Ga0501071_1215479
298 Ga0501073_0129672
299 Ga0501073_0748957
300 Ga0501044_0667927
301 nmdc:mga03n38_117094_c1
302 nmdc:mga03n38_163533_c1
303 nmdc:mga00v17_58772_c1
304 nmdc:mga0yw44_334760_c1
305 nmdc:mga06z11_35611_c1
306 Ga0500651_0526681
307 Ga0500559_0002055
308 Ga0500559_0003280
309 Ga0500559_0046486
310 Ga0500559_0264692
311 Ga0500568_0001019
312 Ga0500573_0000018
313 Ga0500573_0069610
314 Ga0500573_0081893
315 Ga0500573_0132670
316 Ga0500573_0390483
317 Ga0500573_0395117
318 Ga0500573_0529802
319 Ga0500577_0270083
320 Ga0587084_013890
321 2643875833
322 2643885931
323 2643995489
324 2644182845
325 2644198677
326 2644382888
327 2758226518
328 2774384111
329 2808630800
330 2821270408
331 2833711376
332 2852644868
333 2857721979
334 2857730339
335 2857738149
336 2870622798
337 2895663654
338 2904511609
339 2928091761
340 2928123554
341 2939662242
342 2974297568
343 2974326196
344 2977231801
345 2977237159
346 2977254376
347 2977267111
348 2984545052
349 2984581479
350 8016257166

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

7

113

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9713 6 124
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9592 5 127
3mxu-assembly1.cif.gz_A crystal structure of glycine cleavage system protein h from bartonella henselae 0.955 7 106
3a8k-assembly1.cif.gz_E crystal structure of etd97n-ehred complex 0.9483 5 124
2ka7-assembly1.cif.gz_A nmr solution structure of tm0212 at 40 c 0.9478 7 126
ID Description Score Start End Superfamily
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9698 6 124 2.40.50.100
af_Q54JV8_6_144_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9639 6 123 2.40.50.100
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9633 3 122 2.40.50.100
af_A4IC11_1_107_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9572 20 123 2.40.50.100
af_Q4E4F5_6_138_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9551 3 123 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A7S3GD37-F1-model_v4 Glycine cleavage system H protein 0.9962 7 105 GO:0005739
GO:0005960
GO:0019464
AF-A0A0S4QVH0-F1-model_v4 Glycine cleavage system H protein 0.9961 5 124 GO:0005829
GO:0005960
GO:0019464
AF-A0A7Y9ESB0-F1-model_v4 Glycine cleavage system H protein 0.9942 1 125 GO:0005829
GO:0005960
GO:0019464
AF-A0A2U2DT81-F1-model_v4 Glycine cleavage system H protein 0.9922 7 123 GO:0005737
GO:0005960
GO:0019464
AF-A0A258KWQ2-F1-model_v4 Glycine cleavage system H protein 0.9918 7 123 GO:0005737
GO:0005960
GO:0019464

Map