F266712

General Info

Members Datasets Scaffolds Average Seq Length
175 72 167 374

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0000293|Ga0395899_0000293_7490_8686
Length 398
Sequence MTGPTMEASSNRQIGEMGLTYACFSNPVKYCVASFVLALSQACSPSYSHKEKAAPEAIQLSPRLRELFSKTKLVCFGRYALEVPQEAQLIWGSVSFPSKIEVFSGGPSASKIRVVDDVDELKSKNRTAEITYNQAGPIANSWQIRYYESKYDKSEDLYFFDTYVNKGDLTFVLGGAIEDGENEEAAASRETMRAKSLRLRAPDEVPVESGYCIEHGFMKSMQYADQEMVNVGIFLPSLPDVSFSVSSNKNAYSDYPPEEFEKTERAELSLLARIQQAKDDQGIHYPSRTLLREGKRDVQHWHGEESLIKRKDGTHDFEWALVGKPKDVANPSDLDVQMFTKVEHNIVGAAKAASLSDDEAVALWDKLLSGLKFRVKVPGAPPGSYYFPQSGQQHGGGK

Samples

Sample ID Description Type Environment
1 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
2 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
3 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
4 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
10 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
11 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
12 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
13 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
14 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
15 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
16 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
23 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
24 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
25 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
26 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
27 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
28 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
29 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
30 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
31 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
32 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
33 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
34 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
35 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
36 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
37 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
38 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
39 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
40 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
41 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
42 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
43 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
44 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
45 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
46 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
47 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
48 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
49 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
50 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
51 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
52 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
53 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
54 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
55 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
56 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
57 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
58 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
59 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
60 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
61 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
62 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
63 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
64 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
65 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
66 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
67 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
68 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
69 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
70 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
71 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
72 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.71
Metatranscriptomes 0
Isolates 2.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.57
Nodule 0
Rhizoplane 2.29
Rhizosphere 96
Stem 0
Stem Tuber 0
Unclassified 1.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10039424 3300003322 Bacteria 12522
2 rootL2_10083093 3300003322 Bacteria 6232
3 Ga0070658_10025267 3300005327 Bacteria 4762
4 Ga0070660_100010220 3300005339 Bacteria 6623
5 Ga0068855_100022711 3300005563 Bacteria 7517
6 Ga0070664_100072394 3300005564 Bacteria 2955
7 Ga0070664_100187994 3300005564 Bacteria 1839
8 Ga0105241_10010092 3300009174 Bacteria 6933
9 Ga0105241_10181863 3300009174 Unclassified 1745
10 Ga0105242_10020342 3300009176 Bacteria 5203
11 Ga0105237_10114744 3300009545 Plasmid 2686
12 Ga0157372_10157812 3300013307 Bacteria 2621
13 Ga0157372_10170925 3300013307 Bacteria 2515
14 Ga0157372_10223050 3300013307 Bacteria 2185
15 Ga0182007_10057254 3300015262 Bacteria 1279
16 Ga0209148_1001010 3300025254 Bacteria 17789
17 Ga0207705_10004429 3300025909 Bacteria 10614
18 Ga0207654_10005152 3300025911 Bacteria 6594
19 Ga0207654_10218267 3300025911 Bacteria 1263
20 Ga0207671_10129135 3300025914 Unclassified 1938
21 Ga0207657_10017646 3300025919 Bacteria 6838
22 Ga0207679_10020016 3300025945 Plasmid 4509
23 Ga0207667_10019149 3300025949 Bacteria 7655
24 Ga0395899_0000293 3300037312 Bacteria 64438
25 Ga0395899_0004576 3300037312 Bacteria 10779
26 Ga0395899_0007507 3300037312 Bacteria 8424
27 Ga0395899_0009018 3300037312 Bacteria 7666
28 Ga0395899_0012238 3300037312 Bacteria 6571
29 Ga0395899_0019805 3300037312 Bacteria 5106
30 Ga0395899_0031955 3300037312 Bacteria 3955
31 Ga0395899_0192359 3300037312 Unclassified 1427
32 Ga0395900_0000321 3300037418 Bacteria 71088
33 Ga0395900_0000393 3300037418 Bacteria 63296
34 Ga0395900_0005750 3300037418 Bacteria 12956
35 Ga0395900_0011294 3300037418 Bacteria 9136
36 Ga0395900_0012183 3300037418 Bacteria 8789
37 Ga0395900_0031089 3300037418 Bacteria 5484
38 Ga0395900_0031272 3300037418 Bacteria 5467
39 Ga0395900_0043076 3300037418 Bacteria 4651
40 Ga0395900_0055118 3300037418 Bacteria 4093
41 Ga0395900_0223184 3300037418 Bacteria 1898
42 Ga0395900_0282716 3300037418 Unclassified 1650
43 Ga0395898_0023948 3300037466 Bacteria 6162
44 Ga0395898_0027264 3300037466 Bacteria 5737
45 Ga0395898_0031815 3300037466 Bacteria 5270
46 Ga0395898_0131576 3300037466 Unclassified 2396
47 Ga0395898_0147591 3300037466 Bacteria 2251
48 Ga0395898_0264285 3300037466 Bacteria 1641
49 Ga0395905_0007278 3300037471 Bacteria 11031
50 Ga0395905_0022156 3300037471 Bacteria 6010
51 Ga0395905_0036159 3300037471 Bacteria 4638
52 Ga0395905_0040265 3300037471 Bacteria 4383
53 Ga0395905_0059778 3300037471 Bacteria 3563
54 Ga0395905_0141955 3300037471 Bacteria 2259
55 Ga0395905_0361237 3300037471 Bacteria 1345
56 Ga0395901_0000174 3300038443 Bacteria 83279
57 Ga0395901_0000187 3300038443 Bacteria 79696
58 Ga0395901_0002268 3300038443 Bacteria 19631
59 Ga0395901_0003476 3300038443 Bacteria 15868
60 Ga0395901_0037882 3300038443 Bacteria 4986
61 Ga0395901_0070361 3300038443 Bacteria 3645
62 Ga0395901_0104687 3300038443 Bacteria 2969
63 Ga0395901_0172336 3300038443 Bacteria 2270
64 Ga0395901_0205168 3300038443 Bacteria 2065
65 Ga0439449_0011856 3300042007 Bacteria 3276
66 Ga0466965_0065578 3300044683 Unclassified 1819
67 Ga0466965_0070131 3300044683 Bacteria 1761
68 Ga0466966_0000379 3300044684 Bacteria 29048
69 Ga0466966_0006014 3300044684 Bacteria 8009
70 Ga0466966_0016581 3300044684 Bacteria 4865
71 Ga0466961_0040720 3300044693 Unclassified 2978
72 Ga0466961_0046976 3300044693 Bacteria 2761
73 Ga0466957_0000069 3300044842 Bacteria 39949
74 Ga0466957_0026320 3300044842 Bacteria 3451
75 Ga0466957_0289568 3300044842 Unclassified 1098
76 Ga0466959_0007594 3300045049 Bacteria 7621
77 Ga0466967_0053592 3300045976 Bacteria 3546
78 Ga0495617_000010 3300046452 Bacteria 310258
79 Ga0495617_000034 3300046452 Bacteria 147232
80 Ga0495590_0000930 3300046457 Bacteria 12990
81 Ga0495590_0003090 3300046457 Bacteria 6813
82 Ga0495629_0042461 3300046459 Bacteria 3195
83 Ga0495653_0096186 3300046463 Bacteria 2154
84 Ga0495605_0000178 3300046474 Bacteria 80288
85 Ga0495605_0000293 3300046474 Bacteria 55067
86 Ga0495605_0000392 3300046474 Bacteria 40339
87 Ga0495584_0025835 3300046491 Bacteria 2977
88 Ga0495584_0032015 3300046491 Bacteria 2662
89 Ga0495585_0000159 3300046492 Bacteria 72318
90 Ga0495585_0000218 3300046492 Bacteria 59582
91 Ga0495585_0000495 3300046492 Bacteria 37233
92 Ga0495585_0000511 3300046492 Bacteria 36704
93 Ga0495585_0002146 3300046492 Bacteria 14388
94 Ga0495585_0009806 3300046492 Bacteria 5728
95 Ga0495585_0014597 3300046492 Bacteria 4571
96 Ga0495585_0022311 3300046492 Bacteria 3633
97 Ga0495585_0113858 3300046492 Bacteria 1436
98 Ga0495596_0001635 3300046500 Bacteria 12728
99 Ga0495596_0007850 3300046500 Bacteria 4782
100 Ga0495607_0001320 3300046501 Bacteria 22109
101 Ga0495607_0003557 3300046501 Bacteria 11865
102 Ga0495583_0000442 3300046506 Bacteria 62158
103 Ga0495583_0002049 3300046506 Bacteria 18286
104 Ga0495583_0031772 3300046506 Bacteria 2555
105 Ga0495606_0028936 3300046507 Bacteria 3899
106 Ga0495606_0207800 3300046507 Bacteria 1111
107 Ga0495616_0000207 3300046513 Bacteria 48768
108 Ga0495631_0009370 3300046518 Bacteria 4892
109 Ga0495631_0016886 3300046518 Bacteria 3466
110 Ga0495643_0008085 3300046522 Bacteria 6701
111 Ga0495644_0001942 3300046523 Bacteria 8295
112 Ga0495644_0002285 3300046523 Bacteria 7665
113 Ga0495648_0001706 3300046524 Bacteria 21250
114 Ga0495648_0001743 3300046524 Bacteria 21022
115 Ga0495648_0015780 3300046524 Bacteria 5464
116 Ga0495654_0006907 3300046530 Bacteria 6400
117 Ga0495654_0011094 3300046530 Bacteria 4891
118 Ga0495654_0031211 3300046530 Bacteria 2705
119 Ga0495654_0072138 3300046530 Bacteria 1635
120 Ga0495609_0062775 3300046538 Bacteria 1640
121 Ga0495597_0009413 3300046542 Bacteria 4828
122 Ga0495622_0050668 3300046557 Bacteria 1926
123 Ga0495633_0020118 3300046558 Bacteria 3362
124 Ga0495656_0107206 3300046615 Unclassified 1301
125 Ga0495668_0000941 3300046616 Bacteria 32463
126 Ga0495668_0001132 3300046616 Bacteria 27353
127 Ga0495668_0001420 3300046616 Bacteria 23275
128 Ga0495668_0001615 3300046616 Bacteria 21098
129 Ga0495668_0003419 3300046616 Bacteria 11909
130 Ga0495668_0014287 3300046616 Bacteria 4659
131 Ga0495668_0016210 3300046616 Bacteria 4334
132 Ga0495668_0044998 3300046616 Bacteria 2453
133 Ga0495668_0052859 3300046616 Bacteria 2247
134 Ga0495611_0085789 3300046648 Bacteria 1452
135 Ga0495661_0007299 3300046665 Bacteria 7705
136 Ga0495661_0011134 3300046665 Bacteria 6107
137 Ga0495661_0011736 3300046665 Bacteria 5935
138 Ga0495661_0015801 3300046665 Bacteria 5027
139 Ga0495661_0113933 3300046665 Bacteria 1503
140 Ga0495623_0015263 3300046679 Bacteria 4963
141 Ga0495623_0017759 3300046679 Bacteria 4595
142 Ga0495669_0035113 3300046684 Bacteria 2213
143 Ga0495669_0078833 3300046684 Bacteria 1509
144 Ga0495670_0003532 3300046691 Bacteria 7676
145 Ga0495670_0014238 3300046691 Plasmid 3913
146 Ga0495670_0015606 3300046691 Bacteria 3732
147 Ga0495670_0033991 3300046691 Bacteria 2538
148 Ga0495670_0075702 3300046691 Bacteria 1709
149 Ga0495671_0000562 3300046692 Bacteria 27863
150 Ga0495671_0000597 3300046692 Bacteria 26642
151 Ga0495671_0003246 3300046692 Bacteria 10090
152 Ga0495671_0134146 3300046692 Bacteria 1207
153 Ga0495589_0001770 3300046794 Bacteria 12305
154 Ga0495589_0004205 3300046794 Bacteria 7701
155 Ga0495589_0005467 3300046794 Bacteria 6705
156 Ga0495674_0039758 3300047319 Bacteria 4213
157 Ga0495676_0273895 3300047321 Bacteria 1144
158 Ga0495683_0016073 3300047323 Bacteria 3886
159 Ga0495681_0000914 3300047470 Bacteria 22790
160 Ga0495681_0004822 3300047470 Bacteria 9138
161 Ga0495681_0006970 3300047470 Bacteria 7317
162 Ga0495626_0000034 3300048091 Bacteria 183391
163 Ga0496102_0000098 3300048905 Bacteria 123789
164 Ga0496102_0001005 3300048905 Bacteria 26461
165 Ga0496106_0022384 3300048909 Bacteria 4694
166 Ga0495678_001667 3300049459 Bacteria 16882
167 Ga0501035_0022452 3300049822 Bacteria 5795

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044842 Ga0466957_0289568 Ga0466957_0289568_93_1049 318
2 3300046615 Ga0495656_0107206 Ga0495656_0107206_281_1264 327
3 3300046457 Ga0495590_0000930 Ga0495590_0000930_7897_8892 331
4 3300046538 Ga0495609_0062775 Ga0495609_0062775_534_1574 332
5 3300037312 Ga0395899_0019805 Ga0395899_0019805_2458_3471 333
6 3300037418 Ga0395900_0031089 Ga0395900_0031089_1986_2999 333
7 3300037466 Ga0395898_0031815 Ga0395898_0031815_2270_3283 333
8 3300037471 Ga0395905_0141955 Ga0395905_0141955_863_1876 333
9 3300038443 Ga0395901_0002268 Ga0395901_0002268_15868_16881 333
10 3300046530 Ga0495654_0072138 Ga0495654_0072138_295_1320 341
11 3300005339 Ga0070660_100010220 Ga0070660_1000102204 345
12 3300005564 Ga0070664_100072394 Ga0070664_1000723942 345
13 3300009174 Ga0105241_10181863 Ga0105241_101818633 345
14 3300025911 Ga0207654_10218267 Ga0207654_102182672 345
15 3300025919 Ga0207657_10017646 Ga0207657_100176464 345
16 3300025945 Ga0207679_10020016 Ga0207679_100200162 345
17 3300037312 Ga0395899_0009018 Ga0395899_0009018_1406_2443 345
18 3300046491 Ga0495584_0032015 Ga0495584_0032015_634_1671 345
19 3300046507 Ga0495606_0207800 Ga0495606_0207800_54_1091 345
20 3300046518 Ga0495631_0009370 Ga0495631_0009370_3208_4245 345
21 3300046542 Ga0495597_0009413 Ga0495597_0009413_584_1621 345
22 3300046558 Ga0495633_0020118 Ga0495633_0020118_1418_2455 345
23 3300046648 Ga0495611_0085789 Ga0495611_0085789_295_1332 345
24 3300046691 Ga0495670_0015606 Ga0495670_0015606_534_1571 345
25 3300046692 Ga0495671_0134146 Ga0495671_0134146_92_1129 345
26 3300047321 Ga0495676_0273895 Ga0495676_0273895_74_1111 345
27 3300046513 Ga0495616_0000207 Ga0495616_0000207_34729_35769 346
28 3300048905 Ga0496102_0000098 Ga0496102_0000098_31415_32455 346
29 iso_pu_bacteria 2600255292 2601667843 354
30 3300046457 Ga0495590_0000930 Ga0495590_0000930_6279_7358 359
31 3300037312 Ga0395899_0000293 Ga0395899_0000293_6377_7459 360
32 3300046459 Ga0495629_0042461 Ga0495629_0042461_1115_2245 363
33 3300047319 Ga0495674_0039758 Ga0495674_0039758_691_1821 363
34 3300044684 Ga0466966_0000379 Ga0466966_0000379_1898_2998 364
35 3300009176 Ga0105242_10020342 Ga0105242_100203425 365
36 3300037312 Ga0395899_0012238 Ga0395899_0012238_3584_4699 365
37 3300037418 Ga0395900_0012183 Ga0395900_0012183_5343_6458 365
38 3300037466 Ga0395898_0023948 Ga0395898_0023948_3445_4560 365
39 3300037471 Ga0395905_0040265 Ga0395905_0040265_965_2080 365
40 3300038443 Ga0395901_0003476 Ga0395901_0003476_12445_13560 365
41 3300037312 Ga0395899_0031955 Ga0395899_0031955_1070_2176 368
42 3300037418 Ga0395900_0055118 Ga0395900_0055118_911_2017 368
43 3300037466 Ga0395898_0147591 Ga0395898_0147591_104_1210 368
44 3300037471 Ga0395905_0007278 Ga0395905_0007278_6765_7871 368
45 3300038443 Ga0395901_0070361 Ga0395901_0070361_1281_2387 368
46 iso_pu_bacteria 2932410948 2932411458 370
47 iso_pu_bacteria 2932416698 2932418975 370
48 iso_pu_bacteria 2885080285 2885084693 371
49 3300046500 Ga0495596_0001635 Ga0495596_0001635_4395_5519 372
50 3300037312 Ga0395899_0192359 Ga0395899_0192359_292_1413 373
51 3300044684 Ga0466966_0006014 Ga0466966_0006014_1163_2299 373
52 3300044693 Ga0466961_0046976 Ga0466961_0046976_156_1292 373
53 3300015262 Ga0182007_10057254 Ga0182007_100572541 374
54 3300046557 Ga0495622_0050668 Ga0495622_0050668_99_1226 374
55 3300037418 Ga0395900_0011294 Ga0395900_0011294_337_1467 376
56 3300037471 Ga0395905_0022156 Ga0395905_0022156_1126_2256 376
57 3300038443 Ga0395901_0037882 Ga0395901_0037882_48_1178 376
58 3300046491 Ga0495584_0025835 Ga0495584_0025835_1162_2292 376
59 3300046492 Ga0495585_0002146 Ga0495585_0002146_2534_3664 376
60 3300046616 Ga0495668_0014287 Ga0495668_0014287_2601_3731 376
61 3300046665 Ga0495661_0015801 Ga0495661_0015801_3003_4133 376
62 3300046691 Ga0495670_0003532 Ga0495670_0003532_2960_4090 376
63 3300046691 Ga0495670_0075702 Ga0495670_0075702_506_1636 376
64 3300037312 Ga0395899_0004576 Ga0395899_0004576_1291_2424 377
65 3300037418 Ga0395900_0005750 Ga0395900_0005750_6281_7414 377
66 3300037466 Ga0395898_0027264 Ga0395898_0027264_4273_5406 377
67 3300038443 Ga0395901_0205168 Ga0395901_0205168_810_1943 377
68 3300042007 Ga0439449_0011856 Ga0439449_0011856_1526_2659 377
69 3300044683 Ga0466965_0070131 Ga0466965_0070131_309_1442 377
70 3300044842 Ga0466957_0000069 Ga0466957_0000069_25204_26337 377
71 3300045976 Ga0466967_0053592 Ga0466967_0053592_1878_3011 377
72 3300046506 Ga0495583_0031772 Ga0495583_0031772_877_2010 377
73 3300005564 Ga0070664_100187994 Ga0070664_1001879942 378
74 3300037418 Ga0395900_0043076 Ga0395900_0043076_2756_3904 378
75 3300037471 Ga0395905_0036159 Ga0395905_0036159_534_1670 378
76 3300049459 Ga0495678_001667 Ga0495678_001667_5285_6421 378
77 3300044683 Ga0466965_0065578 Ga0466965_0065578_385_1524 379
78 3300044693 Ga0466961_0040720 Ga0466961_0040720_1613_2752 379
79 3300045049 Ga0466959_0007594 Ga0466959_0007594_3609_4748 379
80 3300046452 Ga0495617_000034 Ga0495617_000034_107266_108405 379
81 3300046474 Ga0495605_0000392 Ga0495605_0000392_23963_25102 379
82 3300046492 Ga0495585_0000159 Ga0495585_0000159_63205_64344 379
83 3300046492 Ga0495585_0000218 Ga0495585_0000218_26243_27382 379
84 3300046492 Ga0495585_0000218 Ga0495585_0000218_27605_28744 379
85 3300046492 Ga0495585_0000218 Ga0495585_0000218_29274_30428 379
86 3300046492 Ga0495585_0000495 Ga0495585_0000495_23855_24994 379
87 3300046492 Ga0495585_0009806 Ga0495585_0009806_3705_4844 379
88 3300046492 Ga0495585_0014597 Ga0495585_0014597_2756_3895 379
89 3300046501 Ga0495607_0001320 Ga0495607_0001320_15733_16872 379
90 3300046506 Ga0495583_0000442 Ga0495583_0000442_25549_26688 379
91 3300046523 Ga0495644_0001942 Ga0495644_0001942_4368_5507 379
92 3300046524 Ga0495648_0001706 Ga0495648_0001706_4368_5507 379
93 3300046530 Ga0495654_0011094 Ga0495654_0011094_3073_4212 379
94 3300046616 Ga0495668_0001420 Ga0495668_0001420_5507_6646 379
95 3300046616 Ga0495668_0003419 Ga0495668_0003419_5154_6299 379
96 3300046616 Ga0495668_0044998 Ga0495668_0044998_217_1356 379
97 3300046665 Ga0495661_0007299 Ga0495661_0007299_4863_6002 379
98 3300046665 Ga0495661_0011134 Ga0495661_0011134_2109_3257 379
99 3300046692 Ga0495671_0000562 Ga0495671_0000562_4052_5191 379
100 3300046794 Ga0495589_0001770 Ga0495589_0001770_788_1927 379
101 3300046794 Ga0495589_0005467 Ga0495589_0005467_2652_3800 379
102 3300047470 Ga0495681_0004822 Ga0495681_0004822_5039_6178 379
103 3300048091 Ga0495626_0000034 Ga0495626_0000034_131378_132517 379
104 3300046457 Ga0495590_0003090 Ga0495590_0003090_1844_2986 380
105 3300046679 Ga0495623_0015263 Ga0495623_0015263_1413_2555 380
106 3300003322 rootL2_10083093 rootL2_100830933 381
107 3300005327 Ga0070658_10025267 Ga0070658_100252673 381
108 3300005563 Ga0068855_100022711 Ga0068855_1000227116 381
109 3300025254 Ga0209148_1001010 Ga0209148_100101013 381
110 3300025909 Ga0207705_10004429 Ga0207705_100044298 381
111 3300025949 Ga0207667_10019149 Ga0207667_100191495 381
112 3300037418 Ga0395900_0000321 Ga0395900_0000321_40806_41951 381
113 3300037418 Ga0395900_0282716 Ga0395900_0282716_375_1526 381
114 3300046492 Ga0495585_0113858 Ga0495585_0113858_164_1309 381
115 3300046530 Ga0495654_0031211 Ga0495654_0031211_366_1511 381
116 3300046665 Ga0495661_0113933 Ga0495661_0113933_181_1326 381
117 3300048905 Ga0496102_0001005 Ga0496102_0001005_15546_16691 381
118 3300013307 Ga0157372_10157812 Ga0157372_101578123 382
119 3300037312 Ga0395899_0000293 Ga0395899_0000293_7490_8686 382
120 3300038443 Ga0395901_0000187 Ga0395901_0000187_39186_40343 382
121 3300044684 Ga0466966_0016581 Ga0466966_0016581_3193_4350 382
122 3300046463 Ga0495653_0096186 Ga0495653_0096186_379_1539 382
123 3300046679 Ga0495623_0017759 Ga0495623_0017759_1124_2281 382
124 3300049822 Ga0501035_0022452 Ga0501035_0022452_3645_4802 382
125 3300013307 Ga0157372_10223050 Ga0157372_102230503 383
126 3300044842 Ga0466957_0026320 Ga0466957_0026320_1467_2627 383
127 3300046474 Ga0495605_0000293 Ga0495605_0000293_9329_10489 383
128 3300046492 Ga0495585_0000511 Ga0495585_0000511_2530_3690 383
129 3300046501 Ga0495607_0003557 Ga0495607_0003557_3331_4491 383
130 3300046506 Ga0495583_0002049 Ga0495583_0002049_4851_6008 383
131 3300046507 Ga0495606_0028936 Ga0495606_0028936_2210_3361 383
132 3300046524 Ga0495648_0015780 Ga0495648_0015780_3042_4202 383
133 3300046616 Ga0495668_0000941 Ga0495668_0000941_3522_4682 383
134 3300046616 Ga0495668_0016210 Ga0495668_0016210_2828_3979 383
135 3300046616 Ga0495668_0052859 Ga0495668_0052859_315_1475 383
136 3300046684 Ga0495669_0035113 Ga0495669_0035113_709_1869 383
137 3300046691 Ga0495670_0014238 Ga0495670_0014238_229_1386 383
138 3300046691 Ga0495670_0033991 Ga0495670_0033991_527_1687 383
139 3300046692 Ga0495671_0003246 Ga0495671_0003246_6686_7846 383
140 3300047323 Ga0495683_0016073 Ga0495683_0016073_323_1474 383
141 3300047470 Ga0495681_0000914 Ga0495681_0000914_15926_17083 383
142 3300047470 Ga0495681_0006970 Ga0495681_0006970_3078_4229 383
143 3300037312 Ga0395899_0007507 Ga0395899_0007507_656_1825 384
144 3300037418 Ga0395900_0000393 Ga0395900_0000393_29078_30247 384
145 3300037418 Ga0395900_0031272 Ga0395900_0031272_3889_5058 384
146 3300037466 Ga0395898_0131576 Ga0395898_0131576_552_1706 384
147 3300037466 Ga0395898_0264285 Ga0395898_0264285_308_1477 384
148 3300038443 Ga0395901_0172336 Ga0395901_0172336_690_1859 384
149 3300046452 Ga0495617_000010 Ga0495617_000010_258107_259267 384
150 3300046474 Ga0495605_0000178 Ga0495605_0000178_28137_29297 384
151 3300046492 Ga0495585_0022311 Ga0495585_0022311_2274_3434 384
152 3300046500 Ga0495596_0007850 Ga0495596_0007850_1236_2396 384
153 3300046518 Ga0495631_0016886 Ga0495631_0016886_1192_2352 384
154 3300046523 Ga0495644_0002285 Ga0495644_0002285_3770_4930 384
155 3300046524 Ga0495648_0001743 Ga0495648_0001743_5464_6624 384
156 3300046530 Ga0495654_0006907 Ga0495654_0006907_3484_4644 384
157 3300046616 Ga0495668_0001132 Ga0495668_0001132_21660_22814 384
158 3300046616 Ga0495668_0001615 Ga0495668_0001615_5295_6455 384
159 3300046684 Ga0495669_0078833 Ga0495669_0078833_325_1485 384
160 3300046692 Ga0495671_0000597 Ga0495671_0000597_19261_20421 384
161 3300046794 Ga0495589_0004205 Ga0495589_0004205_941_2101 384
162 3300003322 rootL2_10039424 rootL2_100394244 385
163 3300009174 Ga0105241_10010092 Ga0105241_100100923 385
164 3300009545 Ga0105237_10114744 Ga0105237_101147442 385
165 3300013307 Ga0157372_10170925 Ga0157372_101709253 385
166 3300025911 Ga0207654_10005152 Ga0207654_100051525 385
167 3300025914 Ga0207671_10129135 Ga0207671_101291351 385
168 3300037418 Ga0395900_0223184 Ga0395900_0223184_217_1374 385
169 3300037471 Ga0395905_0059778 Ga0395905_0059778_2380_3537 385
170 3300037471 Ga0395905_0361237 Ga0395905_0361237_90_1247 385
171 3300038443 Ga0395901_0000174 Ga0395901_0000174_64988_66157 385
172 3300038443 Ga0395901_0104687 Ga0395901_0104687_1700_2857 385
173 3300046522 Ga0495643_0008085 Ga0495643_0008085_2457_3614 385
174 3300046665 Ga0495661_0011736 Ga0495661_0011736_3131_4288 385
175 3300048909 Ga0496106_0022384 Ga0496106_0022384_848_2011 385

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18443

Tli4_N

Tle cognate immunity protein 4 N-terminal domain

72

201

0.92

PF18426

Tli4_C

Tle cognate immunity protein 4 C-terminal domain

204

376

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tut-assembly1.cif.gz_A crystal structure of rtca.atp binary complex 0.8383 143 181
5h7y-assembly1.cif.gz_A "structure of immunity protein tplei of t6ss from pseudomonas aeruginosa complexed with ""l"" peptide" 0.7862 57 360
4r1d-assembly1.cif.gz_B the crystal structure of tle4-tli4 complex 0.7844 55 360
5h7y-assembly1.cif.gz_A "structure of immunity protein tplei of t6ss from pseudomonas aeruginosa complexed with ""l"" peptide" 0.7685 57 360
4r1d-assembly1.cif.gz_B the crystal structure of tle4-tli4 complex 0.7681 55 360
ID Description Score Start End Superfamily
af_P46849_185_275_3.65.10.20 Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;RNA 3'-terminal phosphate cyclase domain 0.836 143 181 3.65.10.20
af_O09102_46_162_2.20.25.670 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;GCM domain, large subdomain 0.7021 144 165 2.20.25.670
af_Q5RGE6_387_501_2.60.34.10 Mainly Beta;Sandwich;Substrate Binding Domain Of DNAk; Chain A, domain 1;Substrate Binding Domain Of DNAk; Chain A, domain 1 0.6314 287 329 2.60.34.10
af_P0AEE1_48_185_3.40.1000.10 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.627 213 359 3.40.1000.10
af_O06263_264_400_3.40.1000.10 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.6251 215 356 3.40.1000.10
ID Description Score Start End GO Terms
AF-A0A1S1UFA0-F1-model_v4 Tle cognate immunity protein 4 C-terminal domain-containing protein 0.926 46 379
AF-A0A1S1UFA0-F1-model_v4 Tle cognate immunity protein 4 C-terminal domain-containing protein 0.9207 46 379
AF-A0A290ZP14-F1-model_v4 Tle cognate immunity protein 4 C-terminal domain-containing protein 0.9184 46 363
AF-A0A1N7DBH9-F1-model_v4 Tle cognate immunity protein 4 C-terminal domain-containing protein 0.9163 173 377
AF-A0A255HIT0-F1-model_v4 Tle cognate immunity protein 4 C-terminal domain-containing protein 0.897 253 379

Feature Viewer

pLDDT pTM Quality
79.65 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map