F266270

General Info

Members Datasets Scaffolds Average Seq Length
175 145 174 189

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10869332|Ga0114129_108693321
Length 207
Sequence MNRRPEQRYTGMAKVLTHMCMSLDGFVAQPDDNPAELFDWYWNGDVVVPSAQEGMSFSVDAASAPLLQELTSGCGALIAGRRLFDQSDGWGDNHPAGAPVVVVTHRPPPENAAKRFPRTTFTGSVGEAIATAKELAGDKFVTIASADIIQQALNLGLVDELCISQVPVLFGTGIRYFGELVGGHVILEDPLVVQGARALHLRYAVRR

Samples

Sample ID Description Type Environment
1 2808606372 Agromyces sp. 23-23 Isolate Unclassified
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
19 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
23 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
24 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
25 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
28 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
36 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
58 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
59 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
60 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
61 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
62 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
63 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
64 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
65 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
66 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
67 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
68 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
69 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
70 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
71 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
72 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
73 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
74 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
75 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
76 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
77 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
78 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
79 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
80 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
81 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
82 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
85 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
86 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
87 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
88 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
89 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
90 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
91 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
92 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
93 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
94 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
95 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
96 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
97 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
98 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
99 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
100 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
101 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
102 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
103 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
104 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
132 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
138 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
139 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
142 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
143 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
144 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.86
Metatranscriptomes 0.57
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.29
Nodule 0
Rhizoplane 10.86
Rhizosphere 77.14
Stem 0
Stem Tuber 0
Unclassified 5.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10660410 3300005328 Bacteria 760
2 Ga0070671_100002052 3300005355 Bacteria 15525
3 Ga0070709_10638998 3300005434 Bacteria 823
4 Ga0070714_100988017 3300005435 Bacteria 819
5 Ga0070713_100756197 3300005436 Bacteria 930
6 Ga0070710_10525019 3300005437 Bacteria 814
7 Ga0070708_100126975 3300005445 Bacteria 2358
8 Ga0070678_100032787 3300005456 Bacteria 3599
9 Ga0070678_100234121 3300005456 Bacteria 1533
10 Ga0070662_100480922 3300005457 Bacteria 1034
11 Ga0070681_10513033 3300005458 Bacteria 1112
12 Ga0070693_100073478 3300005547 Bacteria 2020
13 Ga0068855_100460949 3300005563 Bacteria 1386
14 Ga0068861_100052768 3300005719 Bacteria 3092
15 Ga0081455_10117543 3300005937 Bacteria 2101
16 Ga0075365_10023680 3300006038 Bacteria 3865
17 Ga0075365_10159949 3300006038 Unclassified 1569
18 Ga0075364_10074599 3300006051 Unclassified 2237
19 Ga0075364_10098546 3300006051 Bacteria 1945
20 Ga0075364_10618388 3300006051 Bacteria 740
21 Ga0075434_100858859 3300006871 Unclassified 923
22 Ga0075435_100097354 3300007076 Bacteria 2435
23 Ga0105245_10018789 3300009098 Bacteria 6047
24 Ga0105245_10130773 3300009098 Unclassified 2354
25 Ga0105245_10529778 3300009098 Bacteria 1198
26 Ga0114129_10869332 3300009147 Bacteria 1145
27 Ga0105243_10896484 3300009148 Bacteria 882
28 Ga0105242_10697962 3300009176 Bacteria 992
29 Ga0105248_10343624 3300009177 Bacteria 1680
30 Ga0105248_11742815 3300009177 Bacteria 706
31 Ga0105249_10091191 3300009553 Bacteria 2851
32 Ga0105249_10116997 3300009553 Bacteria 2528
33 Ga0105249_11127882 3300009553 Bacteria 855
34 Ga0105246_10155775 3300011119 Bacteria 1735
35 Ga0157378_10119351 3300013297 Bacteria 2429
36 Ga0163162_10897895 3300013306 Bacteria 999
37 Ga0157372_11045288 3300013307 Unclassified 945
38 Ga0157375_10797169 3300013308 Bacteria 1093
39 Ga0157375_11873135 3300013308 Bacteria 712
40 Ga0163163_10640234 3300014325 Bacteria 1127
41 Ga0157379_10186153 3300014968 Bacteria 1876
42 Ga0157376_10407928 3300014969 Bacteria 1315
43 Ga0197907_10339531 3300020069 Unclassified 958
44 Ga0213876_10024286 3300021384 Bacteria 3199
45 Ga0213876_10087803 3300021384 Bacteria 1646
46 Ga0207692_10603102 3300025898 Bacteria 706
47 Ga0207699_10063564 3300025906 Bacteria 2230
48 Ga0207684_10536391 3300025910 Bacteria 1002
49 Ga0207657_10431847 3300025919 Bacteria 1035
50 Ga0207687_10384536 3300025927 Bacteria 1151
51 Ga0207687_10496321 3300025927 Bacteria 1018
52 Ga0207644_10020451 3300025931 Bacteria 4500
53 Ga0207706_10234387 3300025933 Bacteria 1605
54 Ga0207665_10520245 3300025939 Bacteria 921
55 Ga0207667_10831473 3300025949 Bacteria 918
56 Ga0207651_10688795 3300025960 Bacteria 900
57 Ga0207712_10052083 3300025961 Bacteria 2866
58 Ga0207668_10040740 3300025972 Bacteria 3136
59 Ga0207677_10883577 3300026023 Bacteria 805
60 Ga0207703_10010794 3300026035 Bacteria 7126
61 Ga0207703_11156578 3300026035 Bacteria 744
62 Ga0207678_10325248 3300026067 Bacteria 1323
63 Ga0207702_10638702 3300026078 Bacteria 1046
64 Ga0207702_10651187 3300026078 Bacteria 1036
65 Ga0207702_11023171 3300026078 Bacteria 820
66 Ga0207648_10133377 3300026089 Bacteria 2187
67 Ga0207676_10971897 3300026095 Bacteria 836
68 Ga0207683_10416556 3300026121 Bacteria 1237
69 Ga0268264_10828365 3300028381 Bacteria 926
70 Ga0307409_100862013 3300031995 Bacteria 917
71 Ga0373928_0002924 3300035084 Bacteria 3296
72 Ga0373929_0008131 3300035085 Bacteria 1930
73 Ga0373932_0006316 3300035112 Bacteria 2801
74 Ga0373954_0355939 3300035118 Bacteria 723
75 Ga0373924_0484206 3300035410 Unclassified 556
76 Ga0373931_0000001 3300035691 Bacteria 634029
77 Ga0373933_0257846 3300035724 Bacteria 1124
78 Ga0373937_1984389 3300036401 Bacteria 528
79 Ga0373925_0089477 3300037068 Bacteria 2352
80 Ga0436365_0409728 3300039437 Unclassified 2602
81 Ga0436365_0886183 3300039437 Bacteria 15388
82 Ga0436365_1625910 3300039437 Bacteria 8065
83 Ga0436362_0379084 3300039453 Bacteria 716
84 Ga0451789_0891943 3300041443 Bacteria 696
85 Ga0451793_0469229 3300041452 Bacteria 5057
86 Ga0451797_0393491 3300041453 Bacteria 4131
87 Ga0451795_0034065 3300041456 Bacteria 1788
88 Ga0451795_1150809 3300041456 Bacteria 635
89 Ga0451798_0178703 3300041458 Bacteria 693
90 Ga0451837_1630665 3300041494 Bacteria 940
91 Ga0451843_0604577 3300041509 Bacteria 5309
92 Ga0451853_2761806 3300041512 Bacteria 600
93 Ga0466972_0272647 3300044658 Bacteria 791
94 Ga0466965_0039763 3300044683 Bacteria 2313
95 Ga0466965_0416685 3300044683 Bacteria 744
96 Ga0466966_0264534 3300044684 Bacteria 1035
97 Ga0466961_0042093 3300044693 Unclassified 2928
98 Ga0466961_0159577 3300044693 Unclassified 1406
99 Ga0466961_0168238 3300044693 Bacteria 1364
100 Ga0466961_0351614 3300044693 Bacteria 897
101 Ga0466963_0069676 3300044694 Bacteria 2364
102 Ga0466964_0039749 3300044706 Bacteria 1897
103 Ga0466957_0003367 3300044842 Bacteria 8775
104 Ga0466958_0378745 3300045836 Bacteria 912
105 Ga0495592_0414441 3300046454 Bacteria 851
106 Ga0495651_0283738 3300046462 Unclassified 1117
107 Ga0495580_0306143 3300046472 Bacteria 1082
108 Ga0495639_0093256 3300046475 Bacteria 1415
109 Ga0495662_0428673 3300046476 Bacteria 649
110 Ga0495608_0070813 3300046511 Unclassified 2276
111 Ga0495630_0142336 3300046517 Bacteria 1824
112 Ga0495652_0161101 3300046529 Bacteria 1742
113 Ga0495667_0016917 3300046559 Bacteria 4925
114 Ga0495657_0001430 3300046675 Bacteria 20667
115 Ga0495623_0025975 3300046679 Bacteria 3772
116 Ga0495658_0155745 3300046683 Bacteria 1406
117 Ga0495600_0025577 3300046809 Bacteria 3805
118 Ga0495676_1119663 3300047321 Bacteria 500
119 Ga0495680_0032051 3300047322 Bacteria 4270
120 Ga0495593_0340500 3300047673 Bacteria 750
121 Ga0495602_0460143 3300048088 Bacteria 896
122 Ga0496100_0118139 3300048903 Bacteria 1852
123 Ga0496100_0524150 3300048903 Bacteria 915
124 Ga0496101_0081954 3300048904 Bacteria 2387
125 Ga0496102_0108390 3300048905 Bacteria 2587
126 Ga0496102_0339377 3300048905 Bacteria 1415
127 Ga0496107_0126095 3300048910 Bacteria 1888
128 Ga0496109_0306388 3300048912 Bacteria 1498
129 Ga0496109_0473309 3300048912 Bacteria 1183
130 Ga0496109_1095396 3300048912 Bacteria 734
131 Ga0496112_0104983 3300048915 Bacteria 2795
132 Ga0496113_0559912 3300048916 Bacteria 917
133 Ga0496114_0152957 3300048917 Bacteria 2002
134 Ga0496114_0295446 3300048917 Bacteria 1430
135 Ga0496121_0044448 3300048924 Bacteria 3831
136 Ga0501032_0001606 3300049569 Bacteria 18027
137 Ga0501033_0592222 3300049570 Bacteria 761
138 Ga0501034_0086091 3300049571 Bacteria 3144
139 Ga0501036_0158656 3300049572 Bacteria 1908
140 Ga0501037_0014940 3300049573 Bacteria 5711
141 Ga0501038_0019476 3300049574 Bacteria 6116
142 Ga0501039_0714530 3300049575 Bacteria 783
143 Ga0501040_0118003 3300049576 Bacteria 1860
144 Ga0501041_0020929 3300049577 Bacteria 3917
145 Ga0501042_0325034 3300049578 Bacteria 1111
146 Ga0501043_0060057 3300049579 Bacteria 2984
147 Ga0501067_0239811 3300049583 Bacteria 1009
148 Ga0501068_0733830 3300049584 Bacteria 646
149 Ga0501070_0010354 3300049586 Bacteria 7882
150 Ga0501071_0162250 3300049587 Bacteria 1671
151 Ga0501072_0224224 3300049588 Bacteria 1498
152 Ga0501072_0618110 3300049588 Bacteria 854
153 Ga0501077_0245850 3300049593 Bacteria 1137
154 Ga0501080_0039093 3300049742 Bacteria 4428
155 Ga0501083_0024087 3300049744 Bacteria 4220
156 Ga0501035_0562506 3300049822 Bacteria 933
157 Ga0501044_0003535 3300049823 Bacteria 17595
158 Ga0501044_0661480 3300049823 Bacteria 933
159 nmdc:mga03683_161686_c1 3300050489 Unclassified 1014
160 nmdc:mga00v17_51889_c1 3300050491 Bacteria 2494
161 nmdc:mga0yw44_190591_c1 3300050492 Unclassified 1352
162 nmdc:mga09592_136047_c1 3300050508 Bacteria 2116
163 nmdc:mga06r32_647172_c1 3300050510 Bacteria 1025
164 nmdc:mga0rr50_916323_c1 3300050513 Unclassified 747
165 nmdc:mga0a205_704511_c1 3300050515 Bacteria 859
166 Ga0495601_0089151 3300053077 Bacteria 1983
167 Ga0495601_0155154 3300053077 Bacteria 1495
168 Ga0495595_0005437 3300053084 Bacteria 5156
169 Ga0495619_0122630 3300053085 Unclassified 1782
170 Ga0500583_0392106 3300053092 Bacteria 667
171 Ga0500568_0154807 3300053139 Bacteria 847
172 Ga0500616_0000727 3300053153 Bacteria 38047
173 Ga0501084_0270043 3300054114 Bacteria 1436
174 Ga0501082_0093311 3300060353 Bacteria 2601

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035410 Ga0373924_0484206 Ga0373924_0484206_15_443 142
2 3300036401 Ga0373937_1984389 Ga0373937_1984389_16_444 142
3 3300047321 Ga0495676_1119663 Ga0495676_1119663_11_439 142
4 3300046454 Ga0495592_0414441 Ga0495592_0414441_12_527 152
5 3300041512 Ga0451853_2761806 Ga0451853_2761806_29_490 153
6 3300049588 Ga0501072_0224224 Ga0501072_0224224_1025_1486 153
7 3300053092 Ga0500583_0392106 Ga0500583_0392106_39_500 153
8 3300026067 Ga0207678_10325248 Ga0207678_103252482 165
9 3300014968 Ga0157379_10186153 Ga0157379_101861532 173
10 3300009098 Ga0105245_10529778 Ga0105245_105297783 174
11 3300025927 Ga0207687_10496321 Ga0207687_104963213 174
12 3300044693 Ga0466961_0159577 Ga0466961_0159577_718_1287 176
13 3300046529 Ga0495652_0161101 Ga0495652_0161101_422_1012 177
14 3300049744 Ga0501083_0024087 Ga0501083_0024087_1595_2179 177
15 3300053077 Ga0495601_0089151 Ga0495601_0089151_704_1294 177
16 3300054114 Ga0501084_0270043 Ga0501084_0270043_456_1040 177
17 3300050508 nmdc:mga09592_136047_c1 nmdc:mga09592_136047_c1_1470_2033 178
18 3300028381 Ga0268264_10828365 Ga0268264_108283652 179
19 3300005458 Ga0070681_10513033 Ga0070681_105130331 181
20 3300025960 Ga0207651_10688795 Ga0207651_106887951 181
21 3300048912 Ga0496109_1095396 Ga0496109_1095396_130_720 181
22 3300009553 Ga0105249_10116997 Ga0105249_101169971 182
23 3300013308 Ga0157375_10797169 Ga0157375_107971691 182
24 3300014325 Ga0163163_10640234 Ga0163163_106402342 182
25 3300014969 Ga0157376_10407928 Ga0157376_104079282 182
26 3300026035 Ga0207703_11156578 Ga0207703_111565781 182
27 3300026095 Ga0207676_10971897 Ga0207676_109718971 182
28 3300035724 Ga0373933_0257846 Ga0373933_0257846_367_957 182
29 3300037068 Ga0373925_0089477 Ga0373925_0089477_1389_1979 182
30 3300046472 Ga0495580_0306143 Ga0495580_0306143_427_1017 182
31 3300046475 Ga0495639_0093256 Ga0495639_0093256_510_1100 182
32 3300047673 Ga0495593_0340500 Ga0495593_0340500_147_737 182
33 3300005355 Ga0070671_100002052 Ga0070671_1000020526 183
34 3300005456 Ga0070678_100234121 Ga0070678_1002341213 183
35 3300005457 Ga0070662_100480922 Ga0070662_1004809222 183
36 3300006038 Ga0075365_10159949 Ga0075365_101599492 183
37 3300006051 Ga0075364_10074599 Ga0075364_100745992 183
38 3300006051 Ga0075364_10098546 Ga0075364_100985462 183
39 3300009177 Ga0105248_10343624 Ga0105248_103436242 183
40 3300009553 Ga0105249_11127882 Ga0105249_111278821 183
41 3300013308 Ga0157375_11873135 Ga0157375_118731351 183
42 3300021384 Ga0213876_10024286 Ga0213876_100242862 183
43 3300025931 Ga0207644_10020451 Ga0207644_100204511 183
44 3300025933 Ga0207706_10234387 Ga0207706_102343872 183
45 3300026035 Ga0207703_10010794 Ga0207703_100107946 183
46 3300026089 Ga0207648_10133377 Ga0207648_101333773 183
47 3300026121 Ga0207683_10416556 Ga0207683_104165562 183
48 3300035084 Ga0373928_0002924 Ga0373928_0002924_1555_2145 183
49 3300035085 Ga0373929_0008131 Ga0373929_0008131_265_855 183
50 3300035112 Ga0373932_0006316 Ga0373932_0006316_1847_2437 183
51 3300035691 Ga0373931_0000001 Ga0373931_0000001_93328_93918 183
52 3300039437 Ga0436365_1625910 Ga0436365_1625910_5176_5766 183
53 3300049583 Ga0501067_0239811 Ga0501067_0239811_170_769 183
54 3300049587 Ga0501071_0162250 Ga0501071_0162250_73_663 183
55 3300049823 Ga0501044_0661480 Ga0501044_0661480_297_887 183
56 3300050489 nmdc:mga03683_161686_c1 nmdc:mga03683_161686_c1_141_731 183
57 3300050491 nmdc:mga00v17_51889_c1 nmdc:mga00v17_51889_c1_766_1356 183
58 3300050492 nmdc:mga0yw44_190591_c1 nmdc:mga0yw44_190591_c1_198_788 183
59 3300044693 Ga0466961_0042093 Ga0466961_0042093_2011_2601 184
60 3300048912 Ga0496109_0473309 Ga0496109_0473309_96_686 184
61 3300045836 Ga0466958_0378745 Ga0466958_0378745_24_614 185
62 3300049588 Ga0501072_0618110 Ga0501072_0618110_109_699 185
63 3300009176 Ga0105242_10697962 Ga0105242_106979622 187
64 3300011119 Ga0105246_10155775 Ga0105246_101557752 187
65 3300039453 Ga0436362_0379084 Ga0436362_0379084_15_578 187
66 3300041453 Ga0451797_0393491 Ga0451797_0393491_2587_3153 187
67 3300041494 Ga0451837_1630665 Ga0451837_1630665_361_927 187
68 3300041509 Ga0451843_0604577 Ga0451843_0604577_3588_4154 187
69 3300046517 Ga0495630_0142336 Ga0495630_0142336_79_642 187
70 3300053153 Ga0500616_0000727 Ga0500616_0000727_11832_12398 188
71 iso_pu_bacteria 2808606372 2808900888 188
72 3300005456 Ga0070678_100032787 Ga0070678_1000327874 192
73 3300006038 Ga0075365_10023680 Ga0075365_100236803 192
74 3300031995 Ga0307409_100862013 Ga0307409_1008620131 192
75 3300041443 Ga0451789_0891943 Ga0451789_0891943_28_609 192
76 3300041452 Ga0451793_0469229 Ga0451793_0469229_1134_1715 192
77 3300041456 Ga0451795_0034065 Ga0451795_0034065_1022_1603 192
78 3300041458 Ga0451798_0178703 Ga0451798_0178703_81_662 192
79 3300048924 Ga0496121_0044448 Ga0496121_0044448_2523_3125 193
80 3300006051 Ga0075364_10618388 Ga0075364_106183881 195
81 3300053139 Ga0500568_0154807 Ga0500568_0154807_243_830 195
82 3300005328 Ga0070676_10660410 Ga0070676_106604102 196
83 3300005434 Ga0070709_10638998 Ga0070709_106389982 196
84 3300005435 Ga0070714_100988017 Ga0070714_1009880172 196
85 3300005436 Ga0070713_100756197 Ga0070713_1007561971 196
86 3300005437 Ga0070710_10525019 Ga0070710_105250191 196
87 3300005445 Ga0070708_100126975 Ga0070708_1001269752 196
88 3300005547 Ga0070693_100073478 Ga0070693_1000734782 196
89 3300005563 Ga0068855_100460949 Ga0068855_1004609492 196
90 3300005719 Ga0068861_100052768 Ga0068861_1000527683 196
91 3300005937 Ga0081455_10117543 Ga0081455_101175433 196
92 3300006871 Ga0075434_100858859 Ga0075434_1008588591 196
93 3300007076 Ga0075435_100097354 Ga0075435_1000973542 196
94 3300009098 Ga0105245_10018789 Ga0105245_100187894 196
95 3300009098 Ga0105245_10130773 Ga0105245_101307734 196
96 3300009147 Ga0114129_10869332 Ga0114129_108693321 196
97 3300009148 Ga0105243_10896484 Ga0105243_108964842 196
98 3300009177 Ga0105248_11742815 Ga0105248_117428151 196
99 3300009553 Ga0105249_10091191 Ga0105249_100911911 196
100 3300013297 Ga0157378_10119351 Ga0157378_101193512 196
101 3300013306 Ga0163162_10897895 Ga0163162_108978951 196
102 3300013307 Ga0157372_11045288 Ga0157372_110452882 196
103 3300020069 Ga0197907_10339531 Ga0197907_103395311 196
104 3300021384 Ga0213876_10087803 Ga0213876_100878032 196
105 3300025898 Ga0207692_10603102 Ga0207692_106031021 196
106 3300025906 Ga0207699_10063564 Ga0207699_100635642 196
107 3300025910 Ga0207684_10536391 Ga0207684_105363912 196
108 3300025919 Ga0207657_10431847 Ga0207657_104318472 196
109 3300025927 Ga0207687_10384536 Ga0207687_103845362 196
110 3300025939 Ga0207665_10520245 Ga0207665_105202451 196
111 3300025949 Ga0207667_10831473 Ga0207667_108314731 196
112 3300025961 Ga0207712_10052083 Ga0207712_100520831 196
113 3300025972 Ga0207668_10040740 Ga0207668_100407403 196
114 3300026023 Ga0207677_10883577 Ga0207677_108835771 196
115 3300026078 Ga0207702_10638702 Ga0207702_106387022 196
116 3300026078 Ga0207702_10651187 Ga0207702_106511872 196
117 3300026078 Ga0207702_11023171 Ga0207702_110231711 196
118 3300035118 Ga0373954_0355939 Ga0373954_0355939_51_641 196
119 3300039437 Ga0436365_0409728 Ga0436365_0409728_1643_2266 196
120 3300039437 Ga0436365_0886183 Ga0436365_0886183_13500_14096 196
121 3300041456 Ga0451795_1150809 Ga0451795_1150809_10_600 196
122 3300044658 Ga0466972_0272647 Ga0466972_0272647_152_742 196
123 3300044683 Ga0466965_0039763 Ga0466965_0039763_396_995 196
124 3300044683 Ga0466965_0416685 Ga0466965_0416685_135_725 196
125 3300044684 Ga0466966_0264534 Ga0466966_0264534_139_729 196
126 3300044693 Ga0466961_0168238 Ga0466961_0168238_388_987 196
127 3300044693 Ga0466961_0351614 Ga0466961_0351614_33_623 196
128 3300044694 Ga0466963_0069676 Ga0466963_0069676_81_680 196
129 3300044706 Ga0466964_0039749 Ga0466964_0039749_648_1247 196
130 3300044842 Ga0466957_0003367 Ga0466957_0003367_4340_4939 196
131 3300046462 Ga0495651_0283738 Ga0495651_0283738_167_757 196
132 3300046476 Ga0495662_0428673 Ga0495662_0428673_15_605 196
133 3300046511 Ga0495608_0070813 Ga0495608_0070813_606_1196 196
134 3300046559 Ga0495667_0016917 Ga0495667_0016917_3004_3594 196
135 3300046675 Ga0495657_0001430 Ga0495657_0001430_12727_13317 196
136 3300046679 Ga0495623_0025975 Ga0495623_0025975_2278_2868 196
137 3300046683 Ga0495658_0155745 Ga0495658_0155745_261_851 196
138 3300046809 Ga0495600_0025577 Ga0495600_0025577_1791_2381 196
139 3300047322 Ga0495680_0032051 Ga0495680_0032051_3526_4116 196
140 3300048088 Ga0495602_0460143 Ga0495602_0460143_190_780 196
141 3300048903 Ga0496100_0118139 Ga0496100_0118139_725_1315 196
142 3300048903 Ga0496100_0524150 Ga0496100_0524150_71_661 196
143 3300048904 Ga0496101_0081954 Ga0496101_0081954_681_1271 196
144 3300048905 Ga0496102_0108390 Ga0496102_0108390_1503_2093 196
145 3300048905 Ga0496102_0339377 Ga0496102_0339377_572_1168 196
146 3300048910 Ga0496107_0126095 Ga0496107_0126095_658_1248 196
147 3300048912 Ga0496109_0306388 Ga0496109_0306388_379_969 196
148 3300048915 Ga0496112_0104983 Ga0496112_0104983_1733_2323 196
149 3300048916 Ga0496113_0559912 Ga0496113_0559912_245_835 196
150 3300048917 Ga0496114_0152957 Ga0496114_0152957_542_1132 196
151 3300048917 Ga0496114_0295446 Ga0496114_0295446_319_909 196
152 3300049569 Ga0501032_0001606 Ga0501032_0001606_3682_4272 196
153 3300049570 Ga0501033_0592222 Ga0501033_0592222_35_625 196
154 3300049571 Ga0501034_0086091 Ga0501034_0086091_2076_2666 196
155 3300049572 Ga0501036_0158656 Ga0501036_0158656_93_683 196
156 3300049573 Ga0501037_0014940 Ga0501037_0014940_2762_3352 196
157 3300049574 Ga0501038_0019476 Ga0501038_0019476_1102_1692 196
158 3300049575 Ga0501039_0714530 Ga0501039_0714530_168_758 196
159 3300049576 Ga0501040_0118003 Ga0501040_0118003_1245_1835 196
160 3300049577 Ga0501041_0020929 Ga0501041_0020929_742_1332 196
161 3300049578 Ga0501042_0325034 Ga0501042_0325034_504_1094 196
162 3300049579 Ga0501043_0060057 Ga0501043_0060057_2359_2949 196
163 3300049584 Ga0501068_0733830 Ga0501068_0733830_40_630 196
164 3300049586 Ga0501070_0010354 Ga0501070_0010354_358_948 196
165 3300049593 Ga0501077_0245850 Ga0501077_0245850_401_991 196
166 3300049742 Ga0501080_0039093 Ga0501080_0039093_1436_2026 196
167 3300049822 Ga0501035_0562506 Ga0501035_0562506_80_670 196
168 3300049823 Ga0501044_0003535 Ga0501044_0003535_5881_6471 196
169 3300050510 nmdc:mga06r32_647172_c1 nmdc:mga06r32_647172_c1_327_917 196
170 3300050513 nmdc:mga0rr50_916323_c1 nmdc:mga0rr50_916323_c1_15_605 196
171 3300050515 nmdc:mga0a205_704511_c1 nmdc:mga0a205_704511_c1_214_804 196
172 3300053077 Ga0495601_0155154 Ga0495601_0155154_395_985 196
173 3300053084 Ga0495595_0005437 Ga0495595_0005437_171_761 196
174 3300053085 Ga0495619_0122630 Ga0495619_0122630_1109_1699 196
175 3300060353 Ga0501082_0093311 Ga0501082_0093311_1280_1870 196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

13

187

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kgy-assembly1.cif.gz_B crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution 0.8406 1 195
3kgy-assembly1.cif.gz_B crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution 0.8327 1 195
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8015 1 193
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.8007 1 194
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.7965 1 194
ID Description Score Start End Superfamily
3kgyB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7928 2 195 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7919 1 193 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7849 2 196 3.40.430.10
3kgyB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7817 2 195 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7793 1 193 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A538AYX0-F1-model_v4 Deaminase 0.9607 1 196 GO:0008703
GO:0009231
AF-A0A6N7ICZ4-F1-model_v4 Deaminase 0.9437 2 196 GO:0008703
GO:0009231
AF-A0A4R3AU51-F1-model_v4 deleted 0.9338 110 195
AF-A0A3N5U903-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9323 111 196 GO:0008703
GO:0009231
AF-A0A385ZZF6-F1-model_v4 deleted 0.9288 56 196

Feature Viewer

pLDDT pTM Quality
88.3 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map