F265269

General Info

Members Datasets Scaffolds Average Seq Length
174 134 348 336

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0121329|Ga0496121_0121329_56_1165
Length 369
Sequence MIGYEAKEYPVPLGRTYRRRELQMKWRKTMGLMLLCVLMVTVAACGGKEAAPAEQNSNTNAESSNKGDTAALKDIKVVLDWTPNTNHTGLYAAVDQGFYKAEGLNVEIVQPGAGGADTMVASNEVPFGVSYQESVTQARTQGVPLVSIAAVIQHNTSGFAAPADRNIKSPKDFEGKTYGGWGSPVEEAVMQSIMEGDGADVSKVKNINMGDADFFTAVKRDIDFAWIFYAWTGIEAELRGEPIDMLYVKDYSDALDYYTPVLVTNEQTIQNDPELVKAFLKATSEGYQYAIDHPEDAANILIKAVPDLDKDLVLASQKWLSPKYTDDAPRWGEQKQEVWQNYTDWMFSKKLLDEQIDVSKAYTNDFLPQ

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
4 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
7 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
8 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
9 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
10 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
11 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
12 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
13 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
14 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
15 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
16 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
17 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
18 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
19 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
20 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
21 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
22 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
23 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
24 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
25 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
26 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
27 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
28 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
29 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
30 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
31 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
32 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
33 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
34 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
35 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
36 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
37 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
38 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
39 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
40 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
41 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
42 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
43 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
44 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
45 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
46 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
47 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
48 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
49 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
50 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
51 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
52 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
53 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
54 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
55 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
56 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
57 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
58 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
59 2738543010 Bacillus sp. YR335 Isolate Unclassified
60 2738543017 Bacillus sp. OV186 Isolate Unclassified
61 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
62 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
63 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
64 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
65 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
66 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
67 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
68 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
69 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
70 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
71 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
72 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
73 2818991459 Paenibacillus sp. 597 Isolate Unclassified
74 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
75 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
76 2842682962 Bacillus sp. R-72492 Isolate Unclassified
77 2849139964 Bacillus sp. R-71875 Isolate Unclassified
78 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
79 2857581216 Bacillus sp. R-71922 Isolate Unclassified
80 2857586860 Bacillus sp. R-71935 Isolate Unclassified
81 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
82 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
83 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
84 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
85 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
86 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
87 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
88 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
89 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
90 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
91 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
92 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
93 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
94 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
95 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
96 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
97 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
98 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
99 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
100 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
101 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
102 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
103 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
104 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
105 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
106 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
107 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
108 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
109 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
110 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
111 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
112 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
113 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
114 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
115 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
116 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
117 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
118 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
119 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
120 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
121 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
122 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
123 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
124 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
125 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified
126 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
127 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
128 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
129 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
130 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
131 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
132 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
133 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
134 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 47.13
Metatranscriptomes 0.57
Isolates 52.3

Biome Distribution

Category Percentage (%)
Aerial Root 1.15
Bulb 0
Endosphere 17.24
Nodule 0
Rhizoplane 4.6
Rhizosphere 34.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0121329 3300048924 Bacteria 1974
2 JGI25151J46595_10001026 3300003187 Bacteria 20940
3 JGI25151J46595_10003842 3300003187 Bacteria 8131
4 JGI25151J46595_10010397 3300003187 Bacteria 4331
5 JGI25151J46595_10024845 3300003187 Bacteria 2445
6 Ga0055538_1000122 3300003751 Bacteria 58984
7 Ga0055538_1000294 3300003751 Bacteria 25364
8 Ga0055532_1000078 3300003758 Bacteria 121493
9 Ga0055536_1010445 3300003781 Bacteria 3683
10 Ga0055541_1000274 3300003841 Bacteria 17861
11 Ga0105246_10000132 3300011119 Bacteria 34860
12 Ga0157371_10039619 3300013102 Bacteria 3369
13 Ga0157371_10198593 3300013102 Bacteria 1437
14 Ga0209784_100090 3300025224 Bacteria 119291
15 Ga0209784_100103 3300025224 Bacteria 98778
16 Ga0209566_100271 3300025225 Bacteria 48394
17 Ga0209566_100729 3300025225 Bacteria 18508
18 Ga0209566_100737 3300025225 Bacteria 18357
19 Ga0209147_100114 3300025229 Bacteria 144205
20 Ga0209437_100757 3300025233 Bacteria 15615
21 Ga0209675_1001612 3300025291 Bacteria 12721
22 Ga0209676_1000439 3300025292 Bacteria 71078
23 Ga0209676_1000602 3300025292 Bacteria 53113
24 Ga0209676_1002268 3300025292 Bacteria 14125
25 Ga0209676_1037620 3300025292 Bacteria 1394
26 Ga0209025_1000488 3300025294 Bacteria 76500
27 Ga0209025_1000907 3300025294 Bacteria 45806
28 Ga0209025_1003145 3300025294 Bacteria 16122
29 Ga0209025_1005026 3300025294 Bacteria 11043
30 Ga0209025_1009329 3300025294 Bacteria 6867
31 Ga0209025_1009986 3300025294 Bacteria 6506
32 Ga0209025_1010083 3300025294 Bacteria 6461
33 Ga0209025_1017874 3300025294 Bacteria 4063
34 Ga0209025_1032002 3300025294 Bacteria 2471
35 Ga0209371_1002571 3300027312 Bacteria 10002
36 Ga0268256_1002262 3300030500 Bacteria 10032
37 Ga0316582_0136588 3300036647 Bacteria 1651
38 Ga0316582_0182217 3300036647 Bacteria 1429
39 Ga0439439_0000593 3300041406 Bacteria 6355
40 Ga0439449_0001107 3300042007 Bacteria 10601
41 Ga0439457_018027 3300042014 Bacteria 1567
42 Ga0439462_0001973 3300042015 Bacteria 4691
43 Ga0466961_0141796 3300044693 Bacteria 1504
44 Ga0466959_0012349 3300045049 Bacteria 6169
45 Ga0495637_0024658 3300046520 Bacteria 2721
46 Ga0496102_0054603 3300048905 Bacteria 3643
47 Ga0496102_0531897 3300048905 Bacteria 1098
48 Ga0496110_0028212 3300048913 Bacteria 4818
49 Ga0496111_0004103 3300048914 Bacteria 9143
50 Ga0496112_0111751 3300048915 Bacteria 2702
51 Ga0496113_0037801 3300048916 Bacteria 3546
52 Ga0496116_0002449 3300048919 Bacteria 19475
53 Ga0496116_0003247 3300048919 Bacteria 16189
54 Ga0496116_0012599 3300048919 Bacteria 6889
55 Ga0496116_0057374 3300048919 Bacteria 2546
56 Ga0496116_0091469 3300048919 Bacteria 1848
57 Ga0496116_0151829 3300048919 Bacteria 1285
58 Ga0496117_0032365 3300048920 Bacteria 3974
59 Ga0496118_0076632 3300048921 Bacteria 2376
60 Ga0496119_0000912 3300048922 Bacteria 38282
61 Ga0496119_0006373 3300048922 Bacteria 10969
62 Ga0496120_0005960 3300048923 Bacteria 9496
63 Ga0496120_0020043 3300048923 Bacteria 4261
64 Ga0496120_0083063 3300048923 Bacteria 1730
65 Ga0496121_0030534 3300048924 Bacteria 4947
66 Ga0496122_0000041 3300048925 Bacteria 282392
67 Ga0496122_0016626 3300048925 Bacteria 6942
68 Ga0496122_0022979 3300048925 Bacteria 5519
69 Ga0496123_0018812 3300048926 Bacteria 5473
70 Ga0496123_0021331 3300048926 Bacteria 5038
71 Ga0496123_0065014 3300048926 Bacteria 2321
72 Ga0496124_0000662 3300048927 Bacteria 56758
73 Ga0496124_0000805 3300048927 Bacteria 50918
74 Ga0496125_0001220 3300048928 Bacteria 38582
75 Ga0496125_0078029 3300048928 Bacteria 2548
76 Ga0496125_0215103 3300048928 Bacteria 1244
77 Ga0496126_0000168 3300048929 Bacteria 152201
78 Ga0496126_0002230 3300048929 Bacteria 26810
79 Ga0496126_0036242 3300048929 Bacteria 4614
80 Ga0496126_0040972 3300048929 Bacteria 4290
81 nmdc:mga05p37_23793_c1 3300050507 Bacteria 7438
82 nmdc:mga06r32_40814_c1 3300050510 Bacteria 4407
83 Ga0587079_001622 3300059647 Bacteria 2574
84 2550905381 2548877040 Bacteria 7507281
85 2573039085 2571042588 Bacteria 5045676
86 2578334841 2576861424 Bacteria 5270569
87 2580931818 2579778775 Bacteria 5360914
88 2587741330 2585428059 Bacteria 8696589
89 2595089925 2593339131 Bacteria 5116855
90 2601641131 2600255286 Bacteria 5390125
91 2621272871 2619619294 Bacteria 5575484
92 2643741437 2643221543 Bacteria 6628015
93 2644422693 2643221676 Bacteria 8119172
94 2672337379 2671180330 Bacteria 5521719
95 2723601807 2721755693 Bacteria 6126117
96 2728533156 2728368933 Bacteria 7044283
97 2730137907 2728369359 Bacteria 5621728
98 2738840395 2738541299 Bacteria 4020721
99 2739232525 2738543010 Bacteria 5583595
100 2739270796 2738543017 Bacteria 4271950
101 2745169917 2744054657 Bacteria 5016802
102 2753811780 2751185905 Bacteria 6142767
103 2757568186 2757320391 Bacteria 4746095
104 2777760427 2775507177 Bacteria 4384303
105 2777839519 2775507192 Bacteria 4622234
106 2791213728 2788500588 Bacteria 4584915
107 2793186317 2791355222 Bacteria 5898266
108 2802439213 2802428803 Bacteria 5806948
109 2808868093 2808606364 Bacteria 4465927
110 2816862198 2816332186 Bacteria 5331395
111 2817619105 2816332336 Bacteria 5207640
112 2819629559 2818991451 Bacteria 4697364
113 2819668773 2818991459 Bacteria 8736032
114 2821117613 2821111986 Bacteria 6894338
115 2832009313 2832004796 Bacteria 6538017
116 2842684888 2842682962 Bacteria 5589973
117 2849141444 2849139964 Bacteria 5613304
118 2857454125 2857453340 Bacteria 8090534
119 2857584132 2857581216 Bacteria 5522813
120 2857590749 2857586860 Bacteria 4354574
121 2864738175 2864733723 Bacteria 6770668
122 2865003744 2865002811 Bacteria 6333767
123 2866065355 2866065130 Bacteria 6518152
124 2881641577 2881636855 Bacteria 5205297
125 2885528340 2885526491 Bacteria 7164189
126 2889042970 2889042446 Bacteria 7618936
127 2889277879 2889276214 Bacteria 5979355
128 2904114952 2904113452 Bacteria 7796941
129 2904168660 2904162308 Bacteria 7086713
130 2904495921 2904490793 Bacteria 7046938
131 2904597811 2904595352 Bacteria 6124848
132 2904607531 2904606771 Bacteria 4684500
133 2904762390 2904755435 Bacteria 7986759
134 2907206490 2907202186 Bacteria 6632024
135 2919164805 2919160200 Bacteria 6929020
136 2919417699 2919414237 Bacteria 5429133
137 2919426653 2919425241 Bacteria 8055701
138 2929210181 2929206907 Bacteria 5918291
139 2931386396 2931384279 Bacteria 7299545
140 2936340721 2936340661 Bacteria 5139038
141 2938652025 2938649242 Bacteria 7118381
142 2939594143 2939593269 Bacteria 4798695
143 2939684328 2939679117 Bacteria 6921672
144 2939707086 2939702853 Bacteria 5139229
145 2945995035 2945991243 Bacteria 7008369
146 2946057742 2946053406 Bacteria 6978655
147 2968561360 2968558590 Bacteria 6956864
148 2971409855 2971403814 Bacteria 7370929
149 2971415084 2971410472 Bacteria 8311090
150 2971513440 2971511577 Bacteria 5404012
151 2980179136 2980176882 Bacteria 5397533
152 2984532374 2984527788 Bacteria 5288478
153 2984533634 2984532647 Bacteria 5288506
154 2988225904 2988225383 Bacteria 7221625
155 2996637143 2996632988 Bacteria 6921523
156 2996711985 2996706504 Bacteria 5757485
157 3001271131 3001267043 Bacteria 4823521
158 3001276753 3001272096 Bacteria 4729684
159 3006826869 3006826541 Bacteria 4678913
160 3006969173 3006969106 Bacteria 4739423
161 3006983119 3006978542 Bacteria 5328100
162 3006987225 3006984091 Bacteria 4207523
163 3006991491 3006988479 Bacteria 4767936
164 648168355 648028048 Bacteria 5394884
165 8007374777 8007371054 Bacteria 4849201
166 8046997824 8046991243 Bacteria 8497463
167 8054465732 8054465665 Bacteria 7323556
168 8055534625 8055531788 Bacteria 5249694
169 8055635395 8055632911 Bacteria 5283357
170 8056534684 8056533031 Bacteria 8964429
171 8057473946 8057473075 Bacteria 5892720
172 8057633947 8057632132 Bacteria 4726859
173 8057735426 8057733483 Bacteria 6578323
174 8057978821 8057977335 Bacteria 5694872
175 Ga0496121_0121329
176 JGI25151J46595_10001026
177 JGI25151J46595_10003842
178 JGI25151J46595_10010397
179 JGI25151J46595_10024845
180 Ga0055538_1000122
181 Ga0055538_1000294
182 Ga0055532_1000078
183 Ga0055536_1010445
184 Ga0055541_1000274
185 Ga0105246_10000132
186 Ga0157371_10039619
187 Ga0157371_10198593
188 Ga0209784_100090
189 Ga0209784_100103
190 Ga0209566_100271
191 Ga0209566_100729
192 Ga0209566_100737
193 Ga0209147_100114
194 Ga0209437_100757
195 Ga0209675_1001612
196 Ga0209676_1000439
197 Ga0209676_1000602
198 Ga0209676_1002268
199 Ga0209676_1037620
200 Ga0209025_1000488
201 Ga0209025_1000907
202 Ga0209025_1003145
203 Ga0209025_1005026
204 Ga0209025_1009329
205 Ga0209025_1009986
206 Ga0209025_1010083
207 Ga0209025_1017874
208 Ga0209025_1032002
209 Ga0209371_1002571
210 Ga0268256_1002262
211 Ga0316582_0136588
212 Ga0316582_0182217
213 Ga0439439_0000593
214 Ga0439449_0001107
215 Ga0439457_018027
216 Ga0439462_0001973
217 Ga0466961_0141796
218 Ga0466959_0012349
219 Ga0495637_0024658
220 Ga0496102_0054603
221 Ga0496102_0531897
222 Ga0496110_0028212
223 Ga0496111_0004103
224 Ga0496112_0111751
225 Ga0496113_0037801
226 Ga0496116_0002449
227 Ga0496116_0003247
228 Ga0496116_0012599
229 Ga0496116_0057374
230 Ga0496116_0091469
231 Ga0496116_0151829
232 Ga0496117_0032365
233 Ga0496118_0076632
234 Ga0496119_0000912
235 Ga0496119_0006373
236 Ga0496120_0005960
237 Ga0496120_0020043
238 Ga0496120_0083063
239 Ga0496121_0030534
240 Ga0496122_0000041
241 Ga0496122_0016626
242 Ga0496122_0022979
243 Ga0496123_0018812
244 Ga0496123_0021331
245 Ga0496123_0065014
246 Ga0496124_0000662
247 Ga0496124_0000805
248 Ga0496125_0001220
249 Ga0496125_0078029
250 Ga0496125_0215103
251 Ga0496126_0000168
252 Ga0496126_0002230
253 Ga0496126_0036242
254 Ga0496126_0040972
255 nmdc:mga05p37_23793_c1
256 nmdc:mga06r32_40814_c1
257 Ga0587079_001622
258 2550905381
259 2573039085
260 2578334841
261 2580931818
262 2587741330
263 2595089925
264 2601641131
265 2621272871
266 2643741437
267 2644422693
268 2672337379
269 2723601807
270 2728533156
271 2730137907
272 2738840395
273 2739232525
274 2739270796
275 2745169917
276 2753811780
277 2757568186
278 2777760427
279 2777839519
280 2791213728
281 2793186317
282 2802439213
283 2808868093
284 2816862198
285 2817619105
286 2819629559
287 2819668773
288 2821117613
289 2832009313
290 2842684888
291 2849141444
292 2857454125
293 2857584132
294 2857590749
295 2864738175
296 2865003744
297 2866065355
298 2881641577
299 2885528340
300 2889042970
301 2889277879
302 2904114952
303 2904168660
304 2904495921
305 2904597811
306 2904607531
307 2904762390
308 2907206490
309 2919164805
310 2919417699
311 2919426653
312 2929210181
313 2931386396
314 2936340721
315 2938652025
316 2939594143
317 2939684328
318 2939707086
319 2945995035
320 2946057742
321 2968561360
322 2971409855
323 2971415084
324 2971513440
325 2980179136
326 2984532374
327 2984533634
328 2988225904
329 2996637143
330 2996711985
331 3001271131
332 3001276753
333 3006826869
334 3006969173
335 3006983119
336 3006987225
337 3006991491
338 648168355
339 8007374777
340 8046997824
341 8054465732
342 8055534625
343 8055635395
344 8056534684
345 8057473946
346 8057633947
347 8057735426
348 8057978821

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09084

NMT1

NMT1/THI5 like

84

297

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nmy-assembly2.cif.gz_B crystal structure of the thiamin-bound form of substrate-binding protein of abc transporter from clostridium difficile 0.9343 33 329
4nmy-assembly2.cif.gz_B crystal structure of the thiamin-bound form of substrate-binding protein of abc transporter from clostridium difficile 0.9254 33 329
3ix1-assembly1.cif.gz_A periplasmic n-formyl-4-amino-5-aminomethyl-2-methylpyrimidine binding protein from bacillus halodurans 0.8872 32 323
4esx-assembly1.cif.gz_B crystal structure of c. albicans thi5 complexed with plp 0.8671 33 329
4h6d-assembly4.cif.gz_D crystal structure of plp-soaked hmp synthase thi5 from s. cerevisiae 0.8626 33 329
ID Description Score Start End Superfamily
4nmyB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9648 33 329 3.40.190.10
4nmyB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9628 115 217 3.40.190.10
4nmyB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.955 33 329 3.40.190.10
4nmyB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9535 115 217 3.40.190.10
3ix1B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9061 32 323 3.40.190.10
ID Description Score Start End GO Terms
AF-C2Z2K9-F1-model_v4 deleted 0.969 76 329
AF-A0A857A8X8-F1-model_v4 Thiamine pyrimidine synthase 0.9522 40 328 GO:0009228
GO:0016740
GO:0046872
AF-C2Z2K9-F1-model_v4 deleted 0.9507 76 329
AF-A0A2R5EW72-F1-model_v4 ABC transporter substrate-binding protein 0.9463 39 329 GO:0009228
AF-F7YVM2-F1-model_v4 NMT1/THI5-like domain-containing protein 0.9454 1 328 GO:0009228

Map