F265225

General Info

Members Datasets Scaffolds Average Seq Length
174 107 174 233

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0032296|Ga0496102_0032296_2829_3641
Length 270
Sequence VTKITVISVLAQLSFHLTSSSGQGWGLPALAQLQWSMTMFSKTSAADVFRQVPILAGLSEAEVQFLVERAVPRTYEKGELIFTEGDPCAGLFIIESGHVRIFKSSPSGREQVLTVEGPGNSVAELPVFDGGNYPASTAAADKARVYFISKQDFHSLCLVHPQVPLKVLKVVGSRLRRLVGIIEELSFTTVRSRLISVLLRLAKSGKKTAMGIEIELPSSNQELASEIGTVRELVSRNLSRLQAEDLIRMNAKIVVIPDLQRLRDELEQSE

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
64 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
65 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
66 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
67 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
68 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
69 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
70 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
71 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
75 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
76 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
77 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
78 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
79 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
80 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
83 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
84 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
85 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
86 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
87 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
88 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
89 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
90 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
91 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
92 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
93 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
94 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
95 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
96 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
97 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
98 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
99 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
103 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
104 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
105 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
106 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
107 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.9
Rhizosphere 91.95
Stem 0
Stem Tuber 0
Unclassified 1.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10011223 3300001990 Bacteria 2939
2 Ga0070683_100008234 3300005329 Bacteria 8859
3 Ga0070683_100160434 3300005329 Bacteria 2133
4 Ga0070683_100225573 3300005329 Bacteria 1780
5 Ga0068869_100314031 3300005334 Bacteria 1269
6 Ga0068868_100306388 3300005338 Bacteria 1350
7 Ga0070660_100034623 3300005339 Bacteria 3817
8 Ga0070687_100160204 3300005343 Unclassified 1329
9 Ga0070661_100075437 3300005344 Bacteria 2485
10 Ga0070709_10183887 3300005434 Bacteria 1469
11 Ga0070714_100042000 3300005435 Bacteria 3862
12 Ga0070714_100062666 3300005435 Unclassified 3196
13 Ga0070714_100109536 3300005435 Bacteria 2443
14 Ga0070714_100239848 3300005435 Unclassified 1673
15 Ga0070714_100500092 3300005435 Bacteria 1159
16 Ga0070713_100033544 3300005436 Unclassified 4114
17 Ga0070713_100214866 3300005436 Bacteria 1743
18 Ga0070713_100307006 3300005436 Bacteria 1462
19 Ga0070710_10152775 3300005437 Bacteria 1425
20 Ga0070711_100321881 3300005439 Bacteria 1236
21 Ga0070711_100455171 3300005439 Bacteria 1048
22 Ga0070681_10038837 3300005458 Bacteria 4773
23 Ga0070681_10623285 3300005458 Unclassified 993
24 Ga0070679_100608237 3300005530 Unclassified 1036
25 Ga0070684_100023233 3300005535 Bacteria 5182
26 Ga0070684_100318492 3300005535 Unclassified 1428
27 Ga0070695_100277368 3300005545 Unclassified 1230
28 Ga0070693_100110599 3300005547 Unclassified 1689
29 Ga0068855_100077969 3300005563 Unclassified 3844
30 Ga0068855_100099709 3300005563 Bacteria 3345
31 Ga0068855_100153825 3300005563 Bacteria 2614
32 Ga0068855_100209107 3300005563 Bacteria 2193
33 Ga0068855_100330310 3300005563 Bacteria 1683
34 Ga0068855_100477868 3300005563 Bacteria 1357
35 Ga0068857_100346149 3300005577 Bacteria 1376
36 Ga0068856_100258455 3300005614 Bacteria 1757
37 Ga0068856_100652716 3300005614 Unclassified 1073
38 Ga0068856_100928579 3300005614 Unclassified 889
39 Ga0068852_100414628 3300005616 Unclassified 1327
40 Ga0068864_100015717 3300005618 Bacteria 6294
41 Ga0068863_100038755 3300005841 Bacteria 4534
42 Ga0070717_10009522 3300006028 Bacteria 7306
43 Ga0070717_10023172 3300006028 Unclassified 4915
44 Ga0070717_10233231 3300006028 Bacteria 1621
45 Ga0070717_10462661 3300006028 Bacteria 1144
46 Ga0070717_10578650 3300006028 Bacteria 1018
47 Ga0070712_100236016 3300006175 Bacteria 1455
48 Ga0075434_100050494 3300006871 Bacteria 4132
49 Ga0075434_100930075 3300006871 Bacteria 884
50 Ga0075436_100005198 3300006914 Bacteria 8959
51 Ga0075436_100054755 3300006914 Unclassified 2754
52 Ga0075436_100451191 3300006914 Unclassified 936
53 Ga0105240_10029666 3300009093 Bacteria 7119
54 Ga0105240_10165359 3300009093 Bacteria 2624
55 Ga0105240_10579800 3300009093 Unclassified 1237
56 Ga0105241_10240552 3300009174 Unclassified 1530
57 Ga0105241_10548598 3300009174 Bacteria 1037
58 Ga0105248_10038839 3300009177 Bacteria 5329
59 Ga0105248_10078450 3300009177 Bacteria 3712
60 Ga0105248_10153585 3300009177 Bacteria 2597
61 Ga0105237_10064421 3300009545 Bacteria 3661
62 Ga0105237_10249465 3300009545 Bacteria 1777
63 Ga0105237_10906582 3300009545 Bacteria 888
64 Ga0105238_10068355 3300009551 Bacteria 3554
65 Ga0105238_10279468 3300009551 Bacteria 1651
66 Ga0105238_10452419 3300009551 Bacteria 1281
67 Ga0105239_10025785 3300010375 Bacteria 6474
68 Ga0105239_10259353 3300010375 Bacteria 1953
69 Ga0105246_10002568 3300011119 Bacteria 10983
70 Ga0157373_10288402 3300013100 Unclassified 1164
71 Ga0157370_10391052 3300013104 Bacteria 1280
72 Ga0157369_10000563 3300013105 Bacteria 48721
73 Ga0157369_10004578 3300013105 Bacteria 16248
74 Ga0157369_10043138 3300013105 Unclassified 4917
75 Ga0157374_10082057 3300013296 Bacteria 3061
76 Ga0157374_10094116 3300013296 Unclassified 2863
77 Ga0157374_10525848 3300013296 Bacteria 1189
78 Ga0157378_10046661 3300013297 Bacteria 3850
79 Ga0157372_10102087 3300013307 Bacteria 3276
80 Ga0157372_10120340 3300013307 Bacteria 3015
81 Ga0157372_10983148 3300013307 Bacteria 978
82 Ga0157372_11118830 3300013307 Unclassified 911
83 Ga0163163_10081868 3300014325 Bacteria 3231
84 Ga0157376_10010882 3300014969 Bacteria 6680
85 Ga0207692_10229592 3300025898 Unclassified 1104
86 Ga0207699_10233396 3300025906 Unclassified 1261
87 Ga0207705_10016511 3300025909 Bacteria 5290
88 Ga0207654_10159477 3300025911 Bacteria 1456
89 Ga0207707_10030860 3300025912 Bacteria 4688
90 Ga0207707_10041739 3300025912 Bacteria 4006
91 Ga0207707_10090788 3300025912 Bacteria 2669
92 Ga0207695_10016101 3300025913 Bacteria 8772
93 Ga0207693_10385827 3300025915 Bacteria 1095
94 Ga0207663_10327863 3300025916 Bacteria 1152
95 Ga0207662_10325930 3300025918 Unclassified 1026
96 Ga0207657_10000661 3300025919 Bacteria 36699
97 Ga0207652_10548640 3300025921 Bacteria 1039
98 Ga0207646_10480621 3300025922 Unclassified 1120
99 Ga0207694_10349079 3300025924 Unclassified 1224
100 Ga0207700_10096969 3300025928 Bacteria 2342
101 Ga0207700_10105536 3300025928 Bacteria 2256
102 Ga0207664_10005377 3300025929 Bacteria 8752
103 Ga0207664_10024330 3300025929 Bacteria 4551
104 Ga0207664_10500095 3300025929 Unclassified 1088
105 Ga0207661_10014388 3300025944 Bacteria 5798
106 Ga0207661_10256079 3300025944 Bacteria 1557
107 Ga0207679_10143107 3300025945 Unclassified 1935
108 Ga0207667_10039120 3300025949 Bacteria 5056
109 Ga0207667_10047547 3300025949 Bacteria 4541
110 Ga0207667_10115089 3300025949 Bacteria 2772
111 Ga0207667_10152209 3300025949 Bacteria 2380
112 Ga0207667_10190752 3300025949 Bacteria 2103
113 Ga0207674_10015460 3300026116 Bacteria 8385
114 Ga0207674_10238370 3300026116 Bacteria 1766
115 Ga0207674_10311895 3300026116 Bacteria 1522
116 Ga0207698_10139448 3300026142 Unclassified 2086
117 Ga0207698_10874046 3300026142 Unclassified 905
118 Ga0265313_10008296 3300031595 Bacteria 6924
119 Ga0373923_0047442 3300035111 Bacteria 1790
120 Ga0373956_0005801 3300035119 Bacteria 4937
121 Ga0373943_0080774 3300035170 Bacteria 1667
122 Ga0373955_0249989 3300035172 Unclassified 1063
123 Ga0373935_0369858 3300035692 Bacteria 1025
124 Ga0373927_0090381 3300035695 Bacteria 1989
125 Ga0373933_0078370 3300035724 Bacteria 2022
126 Ga0373947_0009623 3300035725 Bacteria 5547
127 Ga0373937_0007939 3300036401 Bacteria 9201
128 Ga0373937_0013702 3300036401 Bacteria 7143
129 Ga0373937_0321071 3300036401 Bacteria 1465
130 Ga0373925_0005805 3300037068 Bacteria 9168
131 Ga0373925_0010375 3300037068 Bacteria 6760
132 Ga0436364_0575109 3300037853 Unclassified 1082
133 Ga0436363_0866043 3300039450 Unclassified 1680
134 Ga0451577_0000536 3300042876 Bacteria 62369
135 Ga0466966_0013268 3300044684 Bacteria 5456
136 Ga0466964_0021302 3300044706 Bacteria 2506
137 Ga0453684_0001218 3300044712 Bacteria 78994
138 Ga0451576_0001764 3300045051 Bacteria 35476
139 Ga0451576_0279227 3300045051 Unclassified 1746
140 Ga0466967_0102180 3300045976 Unclassified 2622
141 Ga0466967_0522582 3300045976 Bacteria 1166
142 Ga0495639_0063686 3300046475 Bacteria 1693
143 Ga0495608_0242762 3300046511 Bacteria 1125
144 Ga0495665_0133781 3300046531 Bacteria 1298
145 Ga0495587_0013201 3300046536 Bacteria 5194
146 Ga0495667_0239494 3300046559 Bacteria 1156
147 Ga0495635_0398194 3300046663 Unclassified 915
148 Ga0495635_0434713 3300046663 Unclassified 869
149 Ga0495659_0052199 3300046664 Bacteria 1491
150 Ga0495623_0068802 3300046679 Bacteria 2207
151 Ga0495669_0056884 3300046684 Bacteria 1764
152 Ga0495669_0163121 3300046684 Unclassified 1058
153 Ga0495581_0207060 3300047315 Unclassified 1147
154 Ga0495674_0164417 3300047319 Bacteria 1855
155 Ga0495674_0394608 3300047319 Unclassified 1118
156 Ga0495684_0468583 3300047471 Unclassified 872
157 Ga0495602_0609786 3300048088 Bacteria 750
158 Ga0496100_0810800 3300048903 Bacteria 734
159 Ga0496102_0032296 3300048905 Unclassified 4703
160 Ga0496102_0253908 3300048905 Bacteria 1658
161 Ga0496104_0119897 3300048907 Bacteria 2525
162 Ga0496106_0537577 3300048909 Bacteria 938
163 Ga0496107_0960288 3300048910 Unclassified 621
164 Ga0496108_0263032 3300048911 Bacteria 1501
165 Ga0496109_0052731 3300048912 Unclassified 3708
166 Ga0496111_0008676 3300048914 Bacteria 6742
167 Ga0496112_0052274 3300048915 Bacteria 4009
168 Ga0496112_0060521 3300048915 Bacteria 3732
169 Ga0496113_0016977 3300048916 Bacteria 5041
170 nmdc:mga0n895_99231_c1 3300050512 Bacteria 2920
171 nmdc:mga0rr50_464503_c1 3300050513 Bacteria 1074
172 nmdc:mga08x19_22435_c1 3300050514 Bacteria 3910
173 nmdc:mga08x19_305789_c1 3300050514 Unclassified 1105
174 nmdc:mga08x19_33225_c1 3300050514 Bacteria 3256

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048910 Ga0496107_0960288 Ga0496107_0960288_21_560 179
2 3300048905 Ga0496102_0253908 Ga0496102_0253908_237_941 206
3 3300050514 nmdc:mga08x19_305789_c1 nmdc:mga08x19_305789_c1_170_874 206
4 3300048903 Ga0496100_0810800 Ga0496100_0810800_11_640 209
5 3300009545 Ga0105237_10906582 Ga0105237_109065821 219
6 3300013296 Ga0157374_10094116 Ga0157374_100941162 219
7 3300048907 Ga0496104_0119897 Ga0496104_0119897_1219_1878 219
8 3300009093 Ga0105240_10029666 Ga0105240_100296666 220
9 3300009177 Ga0105248_10038839 Ga0105248_100388396 220
10 3300011119 Ga0105246_10002568 Ga0105246_100025682 220
11 3300013100 Ga0157373_10288402 Ga0157373_102884022 220
12 3300013105 Ga0157369_10004578 Ga0157369_100045788 220
13 3300013296 Ga0157374_10525848 Ga0157374_105258482 220
14 3300013307 Ga0157372_11118830 Ga0157372_111188301 220
15 3300048909 Ga0496106_0537577 Ga0496106_0537577_13_675 220
16 3300050514 nmdc:mga08x19_22435_c1 nmdc:mga08x19_22435_c1_303_965 220
17 3300005434 Ga0070709_10183887 Ga0070709_101838871 224
18 3300005437 Ga0070710_10152775 Ga0070710_101527752 224
19 3300006871 Ga0075434_100930075 Ga0075434_1009300751 224
20 3300037853 Ga0436364_0575109 Ga0436364_0575109_21_695 224
21 3300050513 nmdc:mga0rr50_464503_c1 nmdc:mga0rr50_464503_c1_254_958 224
22 3300005436 Ga0070713_100214866 Ga0070713_1002148662 225
23 3300005439 Ga0070711_100455171 Ga0070711_1004551711 225
24 3300005577 Ga0068857_100346149 Ga0068857_1003461492 225
25 3300006028 Ga0070717_10578650 Ga0070717_105786501 225
26 3300006914 Ga0075436_100054755 Ga0075436_1000547553 225
27 3300025916 Ga0207663_10327863 Ga0207663_103278632 225
28 3300025929 Ga0207664_10005377 Ga0207664_100053772 225
29 3300026116 Ga0207674_10311895 Ga0207674_103118952 225
30 3300035111 Ga0373923_0047442 Ga0373923_0047442_1015_1692 225
31 3300035119 Ga0373956_0005801 Ga0373956_0005801_3061_3738 225
32 3300035692 Ga0373935_0369858 Ga0373935_0369858_261_938 225
33 3300036401 Ga0373937_0013702 Ga0373937_0013702_1172_1849 225
34 3300037068 Ga0373925_0010375 Ga0373925_0010375_673_1350 225
35 3300044706 Ga0466964_0021302 Ga0466964_0021302_363_1067 225
36 3300047315 Ga0495581_0207060 Ga0495581_0207060_51_728 225
37 3300050514 nmdc:mga08x19_33225_c1 nmdc:mga08x19_33225_c1_2015_2719 225
38 3300013105 Ga0157369_10043138 Ga0157369_100431383 227
39 3300005339 Ga0070660_100034623 Ga0070660_1000346232 228
40 3300005458 Ga0070681_10038837 Ga0070681_100388375 228
41 3300005563 Ga0068855_100099709 Ga0068855_1000997092 228
42 3300005614 Ga0068856_100652716 Ga0068856_1006527161 228
43 3300009174 Ga0105241_10548598 Ga0105241_105485982 228
44 3300009545 Ga0105237_10249465 Ga0105237_102494652 228
45 3300009551 Ga0105238_10452419 Ga0105238_104524192 228
46 3300010375 Ga0105239_10025785 Ga0105239_100257858 228
47 3300010375 Ga0105239_10259353 Ga0105239_102593532 228
48 3300013307 Ga0157372_10102087 Ga0157372_101020873 228
49 3300025909 Ga0207705_10016511 Ga0207705_100165113 228
50 3300025912 Ga0207707_10090788 Ga0207707_100907883 228
51 3300025913 Ga0207695_10016101 Ga0207695_100161014 228
52 3300025919 Ga0207657_10000661 Ga0207657_100006614 228
53 3300025924 Ga0207694_10349079 Ga0207694_103490792 228
54 3300025949 Ga0207667_10039120 Ga0207667_100391205 228
55 3300026142 Ga0207698_10874046 Ga0207698_108740461 228
56 3300005329 Ga0070683_100160434 Ga0070683_1001604342 229
57 3300005329 Ga0070683_100225573 Ga0070683_1002255732 229
58 3300005334 Ga0068869_100314031 Ga0068869_1003140312 229
59 3300005436 Ga0070713_100033544 Ga0070713_1000335443 229
60 3300005563 Ga0068855_100077969 Ga0068855_1000779695 229
61 3300009093 Ga0105240_10165359 Ga0105240_101653592 229
62 3300009545 Ga0105237_10064421 Ga0105237_100644215 229
63 3300025949 Ga0207667_10190752 Ga0207667_101907522 229
64 3300031595 Ga0265313_10008296 Ga0265313_100082963 229
65 3300046679 Ga0495623_0068802 Ga0495623_0068802_279_968 229
66 3300005563 Ga0068855_100153825 Ga0068855_1001538251 230
67 3300025906 Ga0207699_10233396 Ga0207699_102333962 230
68 3300025949 Ga0207667_10115089 Ga0207667_101150893 230
69 3300042876 Ga0451577_0000536 Ga0451577_0000536_17551_18243 230
70 3300044712 Ga0453684_0001218 Ga0453684_0001218_34176_34868 230
71 3300045051 Ga0451576_0001764 Ga0451576_0001764_30000_30692 230
72 3300005343 Ga0070687_100160204 Ga0070687_1001602041 231
73 3300025918 Ga0207662_10325930 Ga0207662_103259301 231
74 3300045976 Ga0466967_0522582 Ga0466967_0522582_135_830 231
75 3300005329 Ga0070683_100008234 Ga0070683_1000082345 232
76 3300005344 Ga0070661_100075437 Ga0070661_1000754373 232
77 3300005439 Ga0070711_100321881 Ga0070711_1003218812 232
78 3300005535 Ga0070684_100023233 Ga0070684_1000232334 232
79 3300005563 Ga0068855_100330310 Ga0068855_1003303101 232
80 3300006028 Ga0070717_10233231 Ga0070717_102332312 232
81 3300006914 Ga0075436_100451191 Ga0075436_1004511911 232
82 3300009551 Ga0105238_10279468 Ga0105238_102794682 232
83 3300013104 Ga0157370_10391052 Ga0157370_103910521 232
84 3300013297 Ga0157378_10046661 Ga0157378_100466615 232
85 3300013307 Ga0157372_10120340 Ga0157372_101203402 232
86 3300013307 Ga0157372_10983148 Ga0157372_109831481 232
87 3300025898 Ga0207692_10229592 Ga0207692_102295921 232
88 3300025912 Ga0207707_10041739 Ga0207707_100417394 232
89 3300025928 Ga0207700_10096969 Ga0207700_100969692 232
90 3300025944 Ga0207661_10256079 Ga0207661_102560792 232
91 3300025949 Ga0207667_10047547 Ga0207667_100475474 232
92 3300036401 Ga0373937_0007939 Ga0373937_0007939_7714_8412 232
93 3300048914 Ga0496111_0008676 Ga0496111_0008676_2438_3136 232
94 3300050512 nmdc:mga0n895_99231_c1 nmdc:mga0n895_99231_c1_75_773 232
95 3300005435 Ga0070714_100500092 Ga0070714_1005000922 233
96 3300014969 Ga0157376_10010882 Ga0157376_100108826 233
97 3300048915 Ga0496112_0052274 Ga0496112_0052274_659_1360 233
98 3300005545 Ga0070695_100277368 Ga0070695_1002773682 234
99 3300005547 Ga0070693_100110599 Ga0070693_1001105992 234
100 3300006871 Ga0075434_100050494 Ga0075434_1000504944 234
101 3300006914 Ga0075436_100005198 Ga0075436_10000519811 234
102 3300009177 Ga0105248_10078450 Ga0105248_100784502 234
103 3300009551 Ga0105238_10068355 Ga0105238_100683553 234
104 3300035170 Ga0373943_0080774 Ga0373943_0080774_378_1082 234
105 3300035695 Ga0373927_0090381 Ga0373927_0090381_40_744 234
106 3300035725 Ga0373947_0009623 Ga0373947_0009623_1959_2663 234
107 3300037068 Ga0373925_0005805 Ga0373925_0005805_3186_3890 234
108 3300047319 Ga0495674_0164417 Ga0495674_0164417_713_1417 234
109 3300044684 Ga0466966_0013268 Ga0466966_0013268_1603_2310 235
110 3300045051 Ga0451576_0279227 Ga0451576_0279227_718_1425 235
111 3300005435 Ga0070714_100042000 Ga0070714_1000420001 236
112 3300005435 Ga0070714_100239848 Ga0070714_1002398482 236
113 3300005458 Ga0070681_10623285 Ga0070681_106232851 236
114 3300006028 Ga0070717_10009522 Ga0070717_100095225 236
115 3300006028 Ga0070717_10023172 Ga0070717_100231723 236
116 3300006028 Ga0070717_10462661 Ga0070717_104626612 236
117 3300006175 Ga0070712_100236016 Ga0070712_1002360162 236
118 3300025915 Ga0207693_10385827 Ga0207693_103858271 236
119 3300025921 Ga0207652_10548640 Ga0207652_105486402 236
120 3300025922 Ga0207646_10480621 Ga0207646_104806212 236
121 3300025928 Ga0207700_10105536 Ga0207700_101055362 236
122 3300025929 Ga0207664_10024330 Ga0207664_100243304 236
123 3300025929 Ga0207664_10500095 Ga0207664_105000952 236
124 3300035172 Ga0373955_0249989 Ga0373955_0249989_333_1043 236
125 3300035724 Ga0373933_0078370 Ga0373933_0078370_513_1223 236
126 3300036401 Ga0373937_0321071 Ga0373937_0321071_508_1218 236
127 3300046663 Ga0495635_0398194 Ga0495635_0398194_154_864 236
128 3300047319 Ga0495674_0394608 Ga0495674_0394608_163_873 236
129 3300048088 Ga0495602_0609786 Ga0495602_0609786_21_731 236
130 3300005338 Ga0068868_100306388 Ga0068868_1003063882 237
131 3300005535 Ga0070684_100318492 Ga0070684_1003184922 237
132 3300005563 Ga0068855_100209107 Ga0068855_1002091072 237
133 3300005614 Ga0068856_100258455 Ga0068856_1002584552 237
134 3300005616 Ga0068852_100414628 Ga0068852_1004146282 237
135 3300005618 Ga0068864_100015717 Ga0068864_1000157175 237
136 3300005841 Ga0068863_100038755 Ga0068863_1000387553 237
137 3300009093 Ga0105240_10579800 Ga0105240_105798002 237
138 3300009177 Ga0105248_10153585 Ga0105248_101535852 237
139 3300013296 Ga0157374_10082057 Ga0157374_100820572 237
140 3300025944 Ga0207661_10014388 Ga0207661_100143883 237
141 3300025945 Ga0207679_10143107 Ga0207679_101431072 237
142 3300025949 Ga0207667_10152209 Ga0207667_101522093 237
143 3300026116 Ga0207674_10015460 Ga0207674_100154604 237
144 3300026116 Ga0207674_10238370 Ga0207674_102383701 237
145 3300026142 Ga0207698_10139448 Ga0207698_101394483 237
146 3300045976 Ga0466967_0102180 Ga0466967_0102180_1314_2033 237
147 3300046475 Ga0495639_0063686 Ga0495639_0063686_369_1082 237
148 3300046531 Ga0495665_0133781 Ga0495665_0133781_145_858 237
149 3300046559 Ga0495667_0239494 Ga0495667_0239494_51_764 237
150 3300046684 Ga0495669_0056884 Ga0495669_0056884_644_1357 237
151 3300048911 Ga0496108_0263032 Ga0496108_0263032_743_1462 237
152 3300048912 Ga0496109_0052731 Ga0496109_0052731_231_950 237
153 3300048916 Ga0496113_0016977 Ga0496113_0016977_1944_2663 237
154 3300005435 Ga0070714_100062666 Ga0070714_1000626663 238
155 3300005435 Ga0070714_100109536 Ga0070714_1001095362 238
156 3300005436 Ga0070713_100307006 Ga0070713_1003070062 238
157 3300005530 Ga0070679_100608237 Ga0070679_1006082371 238
158 3300005563 Ga0068855_100477868 Ga0068855_1004778681 238
159 3300005614 Ga0068856_100928579 Ga0068856_1009285791 238
160 3300009174 Ga0105241_10240552 Ga0105241_102405522 238
161 3300013105 Ga0157369_10000563 Ga0157369_1000056313 238
162 3300014325 Ga0163163_10081868 Ga0163163_100818683 238
163 3300025911 Ga0207654_10159477 Ga0207654_101594772 238
164 3300046663 Ga0495635_0434713 Ga0495635_0434713_71_787 238
165 3300047471 Ga0495684_0468583 Ga0495684_0468583_18_734 238
166 3300048915 Ga0496112_0060521 Ga0496112_0060521_1365_2129 238
167 3300025912 Ga0207707_10030860 Ga0207707_100308604 239
168 3300046511 Ga0495608_0242762 Ga0495608_0242762_233_1012 239
169 3300046536 Ga0495587_0013201 Ga0495587_0013201_821_1600 239
170 3300046664 Ga0495659_0052199 Ga0495659_0052199_331_1077 239
171 3300046684 Ga0495669_0163121 Ga0495669_0163121_27_773 239
172 3300048905 Ga0496102_0032296 Ga0496102_0032296_2829_3641 239
173 3300001990 JGI24737J22298_10011223 JGI24737J22298_100112232 240
174 3300039450 Ga0436363_0866043 Ga0436363_0866043_758_1534 240

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

72

160

0.97

PF00325

Crp

Bacterial regulatory proteins, crp family

216

247

0.94

PF13545

HTH_Crp_2

Crp-like helix-turn-helix domain

192

265

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7fcv-assembly1.cif.gz_D cryo-em structure of the potassium channel akt1 mutant from arabidopsis thaliana 0.9542 15 145
5j3u-assembly1.cif.gz_A co-crystal structure of the regulatory domain of toxoplasma gondii pka with camp 0.9496 13 125
4ku8-assembly3.cif.gz_C structures of pkgi reveal a cgmp-selective activation mechanism 0.9273 14 128
5l0n-assembly1.cif.gz_A pkg i's carboxyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with rp-cgmp 0.9193 14 125
5kjx-assembly1.cif.gz_A co-crystal structure of pka ri alpha cnb-b domain with camp 0.9173 15 126
ID Description Score Start End Superfamily
af_I1KW21_370_502_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9639 17 146 2.60.120.10
af_K7KIP4_365_503_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9581 15 145 2.60.120.10
af_Q5QNI1_349_489_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9555 17 146 2.60.120.10
af_A0A1D6MG59_318_428_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9539 16 116 2.60.120.10
af_Q7T2E5_217_352_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9524 24 125 2.60.120.10
ID Description Score Start End GO Terms
AF-Q5JM04-F1-model_v4 Potassium channel KAT3 0.971 15 142 GO:0005249
GO:0034702
AF-A0A2G2XQ75-F1-model_v4 Potassium channel 0.9627 15 140 GO:0005249
GO:0034702
AF-A0A832KCA8-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9622 10 155 GO:0003700
GO:0005829
GO:0016020
GO:0034220
AF-A0A1Y1RKQ8-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9601 14 155 GO:0004862
GO:0005829
GO:0005952
GO:0030552
GO:0034236
AF-A0A521WYA1-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9519 13 144 GO:0004622
GO:0016020
GO:0016042
GO:0046470

Feature Viewer

pLDDT pTM Quality
90.31 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map