F265051

General Info

Members Datasets Scaffolds Average Seq Length
174 139 349 312

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0055855|Ga0466970_0055855_1047_2066
Length 339
Sequence MTHRMTRERGPRTGRPGPSRRERGALLAASLTAVSLTASGCVVVHGERVVVPAGTRGEAARAVEEFTAAYNKADAAYDASLDAAYTAGPLKVIDAARLKAGHVNHPGGNPQHTPLALSDVRYTIPKKAGWPRWFVADAQANKGGSARWLMVFQRHDVSERWQATYLTLVAPGALPEFEKDADGWAEAVPADASGLAAAPGTLSQGYADYLRSGGSSFADGTHTSALRAQRQKNATRPGLATQYVDEPLTDGDYAPVALRTADGGALVFFSSHHFVKQTAAQGASVPAPNANVRALTTGEIKQTLTMEFVANQVAVDPAGTGGRVSVLARVEGLTSAKGE

Samples

Sample ID Description Type Environment
1 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
8 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
9 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
10 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
11 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
12 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
13 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
14 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
15 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
16 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
17 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
18 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
19 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
20 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
21 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
22 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
23 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
24 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
25 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
26 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
27 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
28 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
29 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
30 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
31 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
32 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
33 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
34 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
35 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
36 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
37 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
38 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
39 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
40 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
41 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
42 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
43 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
44 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
45 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
46 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
47 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
48 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
49 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
50 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
51 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
52 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
53 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
54 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
55 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
56 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
57 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
58 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
59 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
60 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
61 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
62 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
63 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
64 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
65 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
66 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
67 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
68 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
69 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
70 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
71 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
72 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
73 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
74 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
75 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
76 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
77 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
78 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
79 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
80 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
81 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
82 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
83 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
84 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
91 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
92 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
93 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
95 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
96 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
97 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
98 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
99 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
100 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
101 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
102 2643221647 Streptomyces sp. Root369 Isolate Unclassified
103 2643221670 Streptomyces sp. Root431 Isolate Unclassified
104 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
105 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
106 2643221714 Streptomyces sp. Root264 Isolate Unclassified
107 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
108 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
109 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
110 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
111 2808606448 Streptomyces sp. 193411 Isolate Unclassified
112 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
113 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
114 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
115 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
116 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
117 2862574272 Streptomyces sp. AcE210 Isolate Nodule
118 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
119 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
120 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
121 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
122 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
123 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
124 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
125 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
126 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
127 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
128 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
129 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
130 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
131 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
132 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
133 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
134 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
135 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
136 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
137 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
138 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
139 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 73.56
Metatranscriptomes 1.72
Isolates 24.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.72
Nodule 0.57
Rhizoplane 2.3
Rhizosphere 74.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466970_0055855 3300044765 Bacteria 2109
2 rootH1_10001735 3300003316 Bacteria 8403
3 rootH1_10042282 3300003316 Bacteria 2690
4 rootH1_10042282 3300003323 Bacteria 4467
5 rootH2_10071733 3300003320 Bacteria 2898
6 rootL2_10018533 3300003322 Bacteria 8027
7 rootL2_10041504 3300003322 Bacteria 1241
8 rootH1_10007857 3300003323 Bacteria 5638
9 rootH1_10007858 3300003323 Bacteria 2941
10 rootH1_10011944 3300003323 Bacteria 2207
11 rootH1_10011945 3300003323 Bacteria 6488
12 Ga0006562J51391_1020726 3300003578 Bacteria 7060
13 Ga0006562J51391_1020729 3300003578 Bacteria 3460
14 Ga0006562J51391_1020736 3300003578 Bacteria 2660
15 Ga0075363_100011965 3300006048 Bacteria 4170
16 Ga0105246_10226308 3300011119 Bacteria 1470
17 Ga0183367_1009 3300015688 Bacteria 484598
18 Ga0307513_10021940 3300031456 Bacteria 7523
19 Ga0307508_10210964 3300031616 Bacteria 1542
20 Ga0307516_10011652 3300031730 Bacteria 9540
21 Ga0307507_10230449 3300033179 Bacteria 1229
22 Ga0307510_10017702 3300033180 Bacteria 8398
23 Ga0439436_0010094 3300041404 Bacteria 2885
24 Ga0439439_0028463 3300041406 Bacteria 1415
25 Ga0451802_0877388 3300041460 Bacteria 2250
26 Ga0451853_1013095 3300041512 Bacteria 2495
27 Ga0451853_1481757 3300041512 Bacteria 4017
28 Ga0439433_0001520 3300041999 Bacteria 4796
29 Ga0439449_0000694 3300042007 Bacteria 12859
30 Ga0439449_0023584 3300042007 Bacteria 2300
31 Ga0439449_0038815 3300042007 Bacteria 1770
32 Ga0439455_0000157 3300042012 Bacteria 7550
33 Ga0439457_000179 3300042014 Bacteria 16490
34 Ga0439462_0053053 3300042015 Bacteria 1091
35 Ga0466972_0003092 3300044658 Bacteria 8253
36 Ga0466972_0019181 3300044658 Bacteria 3420
37 Ga0466965_0000143 3300044683 Bacteria 20910
38 Ga0466965_0018055 3300044683 Bacteria 3377
39 Ga0466966_0004861 3300044684 Bacteria 8839
40 Ga0466961_0001432 3300044693 Bacteria 14800
41 Ga0466963_0001200 3300044694 Bacteria 13640
42 Ga0466964_0006695 3300044706 Bacteria 4296
43 Ga0466971_0000393 3300044719 Bacteria 16912
44 Ga0466970_0002694 3300044765 Bacteria 8576
45 Ga0466957_0001219 3300044842 Bacteria 13417
46 Ga0466959_0001635 3300045049 Bacteria 13846
47 Ga0466958_0002206 3300045836 Bacteria 9698
48 Ga0466967_0017447 3300045976 Bacteria 5700
49 Ga0495627_019131 3300046453 Bacteria 2302
50 Ga0495603_0004348 3300046455 Bacteria 8451
51 Ga0495603_0005696 3300046455 Bacteria 7446
52 Ga0495590_0009484 3300046457 Bacteria 3695
53 Ga0495629_0003987 3300046459 Bacteria 11102
54 Ga0495629_0021556 3300046459 Bacteria 4598
55 Ga0495629_0028764 3300046459 Bacteria 3945
56 Ga0495629_0236159 3300046459 Bacteria 1259
57 Ga0495638_0087884 3300046460 Bacteria 1877
58 Ga0495582_0089220 3300046473 Bacteria 1718
59 Ga0495639_0008133 3300046475 Bacteria 4505
60 Ga0495662_0007237 3300046476 Bacteria 5493
61 Ga0495662_0014421 3300046476 Bacteria 3843
62 Ga0495662_0035662 3300046476 Bacteria 2400
63 Ga0495662_0073689 3300046476 Bacteria 1656
64 Ga0495594_0016580 3300046499 Bacteria 3884
65 Ga0495594_0099006 3300046499 Bacteria 1639
66 Ga0495583_0074317 3300046506 Bacteria 1488
67 Ga0495606_0007959 3300046507 Bacteria 9329
68 Ga0495606_0115188 3300046507 Bacteria 1616
69 Ga0495610_0098275 3300046512 Bacteria 1315
70 Ga0495616_0019679 3300046513 Bacteria 3681
71 Ga0495620_0005259 3300046515 Bacteria 7242
72 Ga0495620_0034576 3300046515 Bacteria 2281
73 Ga0495630_0098665 3300046517 Bacteria 2210
74 Ga0495631_0007637 3300046518 Bacteria 5493
75 Ga0495643_0019723 3300046522 Bacteria 3897
76 Ga0495648_0082975 3300046524 Bacteria 1817
77 Ga0495652_0061378 3300046529 Bacteria 3174
78 Ga0495586_0065760 3300046535 Bacteria 1977
79 Ga0495597_0030608 3300046542 Bacteria 2452
80 Ga0495645_0123470 3300046543 Bacteria 1821
81 Ga0495622_0004094 3300046557 Bacteria 6803
82 Ga0495633_0018215 3300046558 Bacteria 3571
83 Ga0495634_0074621 3300046642 Bacteria 2228
84 Ga0495625_0180029 3300046660 Bacteria 1406
85 Ga0495635_0061970 3300046663 Bacteria 2568
86 Ga0495635_0107838 3300046663 Bacteria 1902
87 Ga0495588_0001811 3300046674 Bacteria 9107
88 Ga0495657_0002911 3300046675 Bacteria 14208
89 Ga0495657_0041697 3300046675 Bacteria 3139
90 Ga0495613_0052528 3300046689 Bacteria 3001
91 Ga0495613_0125326 3300046689 Bacteria 1842
92 Ga0495613_0195828 3300046689 Bacteria 1426
93 Ga0495624_0139320 3300046690 Bacteria 1486
94 Ga0495649_0034110 3300046694 Bacteria 2801
95 Ga0495649_0066224 3300046694 Bacteria 1938
96 Ga0495589_0005471 3300046794 Bacteria 6702
97 Ga0495589_0111302 3300046794 Bacteria 1321
98 Ga0495581_0041446 3300047315 Bacteria 2664
99 Ga0495604_0135684 3300047317 Bacteria 1763
100 Ga0495636_0012270 3300047318 Bacteria 3393
101 Ga0495636_0090756 3300047318 Bacteria 1326
102 Ga0495672_0039802 3300047320 Bacteria 2856
103 Ga0495676_0022360 3300047321 Bacteria 5501
104 Ga0495676_0037046 3300047321 Bacteria 4065
105 Ga0495680_0013373 3300047322 Bacteria 7163
106 Ga0495687_000786 3300047443 Bacteria 34092
107 Ga0495687_088086 3300047443 Bacteria 1196
108 Ga0495675_0021961 3300047444 Bacteria 4065
109 Ga0495675_0091533 3300047444 Bacteria 1909
110 Ga0495685_002175 3300047447 Bacteria 6091
111 Ga0495685_043773 3300047447 Bacteria 1527
112 Ga0495684_0216059 3300047471 Bacteria 1408
113 Ga0495593_0077362 3300047673 Bacteria 1723
114 Ga0495614_0110019 3300048089 Bacteria 1209
115 Ga0495626_0008819 3300048091 Bacteria 5485
116 Ga0496108_0068280 3300048911 Bacteria 2999
117 Ga0496109_0055588 3300048912 Bacteria 3611
118 Ga0496110_0082751 3300048913 Bacteria 2863
119 Ga0501034_0007457 3300049571 Bacteria 11641
120 Ga0501038_0043931 3300049574 Bacteria 3884
121 Ga0501039_0008633 3300049575 Bacteria 7764
122 Ga0501043_0006948 3300049579 Bacteria 9020
123 Ga0501046_0043572 3300049580 Bacteria 3572
124 Ga0501047_0052050 3300049581 Bacteria 3957
125 Ga0501068_0031562 3300049584 Bacteria 3147
126 Ga0501070_0001456 3300049586 Bacteria 21167
127 Ga0501074_0002784 3300049590 Bacteria 12232
128 Ga0501035_0001672 3300049822 Bacteria 22429
129 Ga0501044_0313748 3300049823 Bacteria 1494
130 Ga0501044_0318235 3300049823 Bacteria 1481
131 nmdc:mga03n38_5601_c1 3300050490 Bacteria 4291
132 nmdc:mga0yw44_12073_c1 3300050492 Bacteria 3231
133 2547407700 2547132111 Bacteria 8013147
134 2554258835 2554235005 Bacteria 6457341
135 2585311501 2582581313 Bacteria 10042643
136 2616694443 2616644814 Bacteria 11555299
137 2643944997 2643221587 Bacteria 7586415
138 2644267654 2643221647 Bacteria 10741251
139 2644385849 2643221670 Bacteria 6497041
140 2644431896 2643221677 Bacteria 7584031
141 2644435952 2643221678 Bacteria 9540101
142 2644632190 2643221714 Bacteria 9015452
143 2784587550 2784132148 Bacteria 8627943
144 2785368089 2784746768 Bacteria 10036182
145 2786669143 2786546132 Bacteria 10419719
146 2808840749 2808606359 Bacteria 9866990
147 2809231114 2808606448 Bacteria 8656184
148 2812359432 2811994879 Bacteria 9313447
149 2812481576 2811994917 Bacteria 7761064
150 2852640629 2852635781 Bacteria 8251373
151 2862288518 2862281513 Bacteria 9621493
152 2862515127 2862507626 Bacteria 9425308
153 2862582739 2862574272 Bacteria 10567477
154 2873156878 2873151551 Bacteria 8625867
155 2912721474 2912715099 Bacteria 9460473
156 2912759673 2912757875 Bacteria 7940295
157 2918503380 2918501144 Bacteria 8668083
158 2919468298 2919468124 Bacteria 9133025
159 2946066488 2946064051 Bacteria 8957905
160 2946074733 2946072368 Bacteria 8999607
161 2947230890 2947224130 Bacteria 9938529
162 2954004174 2954002825 Bacteria 9173742
163 2954675441 2954673503 Bacteria 9685905
164 2954688691 2954682443 Bacteria 9862841
165 2954717443 2954711539 Bacteria 10867210
166 2954727398 2954721474 Bacteria 10456478
167 2954734394 2954731030 Bacteria 10243860
168 2954746302 2954740390 Bacteria 10229294
169 2954753277 2954749733 Bacteria 10366972
170 2954765415 2954759201 Bacteria 9358192
171 3006322256 3006321560 Bacteria 8247479
172 3006397590 3006393351 Bacteria 6615579
173 3006501992 3006493962 Bacteria 8825450
174 8023625422 8023623736 Bacteria 8593882
175 8025533681 8025530807 Bacteria 8495698
176 Ga0466970_0055855
177 rootH1_10001735
178 rootH1_10042282
179 rootH2_10071733
180 rootL2_10018533
181 rootL2_10041504
182 rootH1_10007857
183 rootH1_10007858
184 rootH1_10011944
185 rootH1_10011945
186 Ga0006562J51391_1020726
187 Ga0006562J51391_1020729
188 Ga0006562J51391_1020736
189 Ga0075363_100011965
190 Ga0105246_10226308
191 Ga0183367_1009
192 Ga0307513_10021940
193 Ga0307508_10210964
194 Ga0307516_10011652
195 Ga0307507_10230449
196 Ga0307510_10017702
197 Ga0439436_0010094
198 Ga0439439_0028463
199 Ga0451802_0877388
200 Ga0451853_1013095
201 Ga0451853_1481757
202 Ga0439433_0001520
203 Ga0439449_0000694
204 Ga0439449_0023584
205 Ga0439449_0038815
206 Ga0439455_0000157
207 Ga0439457_000179
208 Ga0439462_0053053
209 Ga0466972_0003092
210 Ga0466972_0019181
211 Ga0466965_0000143
212 Ga0466965_0018055
213 Ga0466966_0004861
214 Ga0466961_0001432
215 Ga0466963_0001200
216 Ga0466964_0006695
217 Ga0466971_0000393
218 Ga0466970_0002694
219 Ga0466957_0001219
220 Ga0466959_0001635
221 Ga0466958_0002206
222 Ga0466967_0017447
223 Ga0495627_019131
224 Ga0495603_0004348
225 Ga0495603_0005696
226 Ga0495590_0009484
227 Ga0495629_0003987
228 Ga0495629_0021556
229 Ga0495629_0028764
230 Ga0495629_0236159
231 Ga0495638_0087884
232 Ga0495582_0089220
233 Ga0495639_0008133
234 Ga0495662_0007237
235 Ga0495662_0014421
236 Ga0495662_0035662
237 Ga0495662_0073689
238 Ga0495594_0016580
239 Ga0495594_0099006
240 Ga0495583_0074317
241 Ga0495606_0007959
242 Ga0495606_0115188
243 Ga0495610_0098275
244 Ga0495616_0019679
245 Ga0495620_0005259
246 Ga0495620_0034576
247 Ga0495630_0098665
248 Ga0495631_0007637
249 Ga0495643_0019723
250 Ga0495648_0082975
251 Ga0495652_0061378
252 Ga0495586_0065760
253 Ga0495597_0030608
254 Ga0495645_0123470
255 Ga0495622_0004094
256 Ga0495633_0018215
257 Ga0495634_0074621
258 Ga0495625_0180029
259 Ga0495635_0061970
260 Ga0495635_0107838
261 Ga0495588_0001811
262 Ga0495657_0002911
263 Ga0495657_0041697
264 Ga0495613_0052528
265 Ga0495613_0125326
266 Ga0495613_0195828
267 Ga0495624_0139320
268 Ga0495649_0034110
269 Ga0495649_0066224
270 Ga0495589_0005471
271 Ga0495589_0111302
272 Ga0495581_0041446
273 Ga0495604_0135684
274 Ga0495636_0012270
275 Ga0495636_0090756
276 Ga0495672_0039802
277 Ga0495676_0022360
278 Ga0495676_0037046
279 Ga0495680_0013373
280 Ga0495687_000786
281 Ga0495687_088086
282 Ga0495675_0021961
283 Ga0495675_0091533
284 Ga0495685_002175
285 Ga0495685_043773
286 Ga0495684_0216059
287 Ga0495593_0077362
288 Ga0495614_0110019
289 Ga0495626_0008819
290 Ga0496108_0068280
291 Ga0496109_0055588
292 Ga0496110_0082751
293 Ga0501034_0007457
294 Ga0501038_0043931
295 Ga0501039_0008633
296 Ga0501043_0006948
297 Ga0501046_0043572
298 Ga0501047_0052050
299 Ga0501068_0031562
300 Ga0501070_0001456
301 Ga0501074_0002784
302 Ga0501035_0001672
303 Ga0501044_0313748
304 Ga0501044_0318235
305 nmdc:mga03n38_5601_c1
306 nmdc:mga0yw44_12073_c1
307 2547407700
308 2554258835
309 2585311501
310 2616694443
311 2643944997
312 2644267654
313 2644385849
314 2644431896
315 2644435952
316 2644632190
317 2784587550
318 2785368089
319 2786669143
320 2808840749
321 2809231114
322 2812359432
323 2812481576
324 2852640629
325 2862288518
326 2862515127
327 2862582739
328 2873156878
329 2912721474
330 2912759673
331 2918503380
332 2919468298
333 2946066488
334 2946074733
335 2947230890
336 2954004174
337 2954675441
338 2954688691
339 2954717443
340 2954727398
341 2954734394
342 2954746302
343 2954753277
344 2954765415
345 3006322256
346 3006397590
347 3006501992
348 8023625422
349 8025533681

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u9o-assembly1.cif.gz_G cocrystal structure of the intermembrane space region of the plastid division proteins parc6 and pdv1 0.6851 37 154
6jzn-assembly1.cif.gz_C structure of the intermembrane space region of parc6-pdv1 0.5927 37 154
5u9o-assembly1.cif.gz_G cocrystal structure of the intermembrane space region of the plastid division proteins parc6 and pdv1 0.5914 37 154
5ig3-assembly1.cif.gz_F crystal structure of the human camkii-alpha hub 0.5741 227 320
4lso-assembly1.cif.gz_A crystal structure of the soluble domain of a type iv secretion system protein virb8 from bartonella quintana toulouse 0.5665 223 320
ID Description Score Start End Superfamily
af_Q54WM5_152_323_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.5873 41 152 3.10.450.240
af_P96818_5_130_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.5851 211 318 3.10.450.50
af_I1M0K3_150_241_3.10.450.10 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.5849 78 152 3.10.450.10
2qiyA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.563 40 157 3.10.450.50
af_K7VPW5_91_183_3.10.450.10 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.5564 78 152 3.10.450.10
ID Description Score Start End GO Terms
AF-A0A2G7EVU0-F1-model_v4 deleted 0.9859 29 326
AF-A0A4R3FLU1-F1-model_v4 deleted 0.9813 29 326
AF-V6K467-F1-model_v4 Lipoprotein 0.9805 36 326
AF-V6K467-F1-model_v4 Lipoprotein 0.9771 36 326
AF-A0A2G7EVU0-F1-model_v4 deleted 0.9761 29 326

Map