F264788

General Info

Members Datasets Scaffolds Average Seq Length
174 128 348 235

Family's Representative Sequence

Representative Sequence 3300030878|Ga0265770_1009877|Ga0265770_10098771
Length 270
Sequence MRCEKHRSRRKSAYDLCATLINQMSGSLTASPIEEGRSGDPELALIPAGWFCMGSEAGQENERPVHRAWVDAVYFATCQVTNAEYGRFLRATGSQAPPLWDDPNFNYPEQPVVAVSWFEAVKYCEWLSELNGRRYRLPMEAEWERAARGGFESRLFPWGDDPPESLPNYGERWKAGPEPVGLSMPNAFGLHDMCQNVHEWCNDWYRPDYYAVSPERNPRGPDSGERRASRGGSWRHHVKVTRCAARSSIPPHFQYADYGFRVASDPLTSI

Samples

Sample ID Description Type Environment
1 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
103 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
116 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
128 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.98
Metatranscriptomes 4.02
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.6
Rhizosphere 95.4
Stem 0
Stem Tuber 0
Unclassified 13.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265770_1009877 3300030878 Unclassified 1379
2 MBSR1b_contig_831446 2162886012 Bacteria 2964
3 LJNas_1000712 3300000546 Bacteria 5595
4 JGI24752J21851_1000691 3300001976 Bacteria 4508
5 Ga0065712_10123379 3300005290 Bacteria 1639
6 Ga0065715_10091077 3300005293 Bacteria 6144
7 Ga0070658_10105845 3300005327 Bacteria 2327
8 Ga0070690_100008269 3300005330 Bacteria 5985
9 Ga0068869_100007756 3300005334 Bacteria 6883
10 Ga0070666_10019520 3300005335 Bacteria 4377
11 Ga0070680_100196817 3300005336 Bacteria 1699
12 Ga0070682_100020375 3300005337 Bacteria 3900
13 Ga0068868_100001727 3300005338 Bacteria 14969
14 Ga0068868_100013441 3300005338 Bacteria 6002
15 Ga0070660_100008269 3300005339 Bacteria 7271
16 Ga0070687_100000859 3300005343 Bacteria 10193
17 Ga0070675_100013076 3300005354 Bacteria 6521
18 Ga0070671_100019576 3300005355 Bacteria 5511
19 Ga0070659_100006119 3300005366 Bacteria 8683
20 Ga0070667_100037279 3300005367 Bacteria 4076
21 Ga0070667_100065392 3300005367 Unclassified 3088
22 Ga0070667_100137980 3300005367 Bacteria 2133
23 Ga0070714_100003325 3300005435 Bacteria 11986
24 Ga0070714_100046773 3300005435 Bacteria 3672
25 Ga0070713_100016431 3300005436 Bacteria 5565
26 Ga0070713_100029597 3300005436 Bacteria 4340
27 Ga0070710_10000881 3300005437 Bacteria 14369
28 Ga0070710_10050656 3300005437 Unclassified 2329
29 Ga0070710_10084706 3300005437 Bacteria 1858
30 Ga0070701_10017230 3300005438 Bacteria 3374
31 Ga0070711_100004478 3300005439 Bacteria 8255
32 Ga0070700_100049186 3300005441 Bacteria 2616
33 Ga0070708_100152558 3300005445 Bacteria 2149
34 Ga0070708_100639054 3300005445 Unclassified 1003
35 Ga0070678_100006009 3300005456 Bacteria 7076
36 Ga0070662_100149948 3300005457 Bacteria 1814
37 Ga0070707_100308962 3300005468 Bacteria 1537
38 Ga0070699_100089687 3300005518 Bacteria 2687
39 Ga0070697_100614484 3300005536 Bacteria 956
40 Ga0070693_100022302 3300005547 Bacteria 3364
41 Ga0070665_100121439 3300005548 Bacteria 2614
42 Ga0068854_100009804 3300005578 Bacteria 6193
43 Ga0070702_100005603 3300005615 Bacteria 5872
44 Ga0068859_100007183 3300005617 Bacteria 11305
45 Ga0068866_10163221 3300005718 Bacteria 1301
46 Ga0068861_100220062 3300005719 Bacteria 1604
47 Ga0068858_100015804 3300005842 Bacteria 7098
48 Ga0068860_100024974 3300005843 Bacteria 5770
49 Ga0068862_100097899 3300005844 Unclassified 2562
50 Ga0070717_10001393 3300006028 Bacteria 16645
51 Ga0070717_10001889 3300006028 Bacteria 14654
52 Ga0070717_10035429 3300006028 Bacteria 4040
53 Ga0070717_10512672 3300006028 Unclassified 1084
54 Ga0070715_10003144 3300006163 Bacteria 5194
55 Ga0070712_100003020 3300006175 Bacteria 10412
56 Ga0070712_100237975 3300006175 Bacteria 1449
57 Ga0097621_100001455 3300006237 Bacteria 16196
58 Ga0068871_100002024 3300006358 Bacteria 13726
59 Ga0068871_100194991 3300006358 Unclassified 1746
60 Ga0075428_100022921 3300006844 Bacteria 6911
61 Ga0075431_100059777 3300006847 Bacteria 3933
62 Ga0075436_100156634 3300006914 Bacteria 1605
63 Ga0097620_100007183 3300006931 Bacteria 11305
64 Ga0099794_10065216 3300007265 Unclassified 1776
65 Ga0105240_10096230 3300009093 Bacteria 3609
66 Ga0105245_10003969 3300009098 Bacteria 13153
67 Ga0105241_10283847 3300009174 Bacteria 1415
68 Ga0105242_10138240 3300009176 Bacteria 2111
69 Ga0105242_10223466 3300009176 Unclassified 1684
70 Ga0105248_10157816 3300009177 Unclassified 2560
71 Ga0105248_10709915 3300009177 Bacteria 1135
72 Ga0105237_10088180 3300009545 Unclassified 3092
73 Ga0105237_10229173 3300009545 Bacteria 1858
74 Ga0099796_10035195 3300010159 Bacteria 1659
75 Ga0105239_10043303 3300010375 Bacteria 4934
76 Ga0105239_10186677 3300010375 Bacteria 2320
77 Ga0105239_10341370 3300010375 Bacteria 1690
78 Ga0157373_10062406 3300013100 Bacteria 2639
79 Ga0157369_10162262 3300013105 Bacteria 2359
80 Ga0157369_10632418 3300013105 Bacteria 1104
81 Ga0157374_10157642 3300013296 Bacteria 2210
82 Ga0157374_10222613 3300013296 Bacteria 1852
83 Ga0157378_10001149 3300013297 Bacteria 24055
84 Ga0157378_10095794 3300013297 Bacteria 2704
85 Ga0163162_10013096 3300013306 Bacteria 8098
86 Ga0163162_10312843 3300013306 Bacteria 1703
87 Ga0163162_10632656 3300013306 Bacteria 1194
88 Ga0157372_10110965 3300013307 Bacteria 3141
89 Ga0157375_10010099 3300013308 Bacteria 8300
90 Ga0157375_10126322 3300013308 Bacteria 2673
91 Ga0163163_10000850 3300014325 Bacteria 25970
92 Ga0163163_10331728 3300014325 Bacteria 1576
93 Ga0182008_10083198 3300014497 Unclassified 1576
94 Ga0157377_10000535 3300014745 Bacteria 16132
95 Ga0157376_10271789 3300014969 Bacteria 1593
96 Ga0157376_10413671 3300014969 Bacteria 1307
97 Ga0228598_1000687 3300024227 Bacteria 7168
98 Ga0207656_10143637 3300025321 Unclassified 1126
99 Ga0207692_10006197 3300025898 Bacteria 4842
100 Ga0207642_10125986 3300025899 Bacteria 1329
101 Ga0207685_10037310 3300025905 Unclassified 1788
102 Ga0207684_10002533 3300025910 Bacteria 18367
103 Ga0207693_10000038 3300025915 Bacteria 109225
104 Ga0207663_10003648 3300025916 Bacteria 7563
105 Ga0207646_10002290 3300025922 Bacteria 22746
106 Ga0207646_10310135 3300025922 Bacteria 1426
107 Ga0207700_10001212 3300025928 Bacteria 14785
108 Ga0207664_10010642 3300025929 Bacteria 6503
109 Ga0207706_10207922 3300025933 Bacteria 1716
110 Ga0207704_10103923 3300025938 Unclassified 1901
111 Ga0207665_10017505 3300025939 Bacteria 4710
112 Ga0207711_10670878 3300025941 Bacteria 967
113 Ga0207689_10021351 3300025942 Bacteria 5444
114 Ga0207661_10273187 3300025944 Unclassified 1509
115 Ga0207667_10141637 3300025949 Unclassified 2476
116 Ga0207640_10503181 3300025981 Unclassified 1009
117 Ga0207703_10001482 3300026035 Bacteria 21398
118 Ga0207703_10666351 3300026035 Bacteria 988
119 Ga0207639_10219737 3300026041 Unclassified 1640
120 Ga0207641_10383925 3300026088 Bacteria 1346
121 Ga0207641_11003943 3300026088 Unclassified 831
122 Ga0265356_1000309 3300028017 Bacteria 9112
123 Ga0265356_1003783 3300028017 Unclassified 1883
124 Ga0268265_10014605 3300028380 Bacteria 5354
125 Ga0265338_10015603 3300028800 Bacteria 8325
126 Ga0265338_10081914 3300028800 Bacteria 2703
127 Ga0265338_10121027 3300028800 Bacteria 2086
128 Ga0265762_1000635 3300030760 Bacteria 6176
129 Ga0265762_1001637 3300030760 Bacteria 4078
130 Ga0265760_10000193 3300031090 Bacteria 16134
131 Ga0265760_10006221 3300031090 Bacteria 3414
132 Ga0265760_10008091 3300031090 Bacteria 3004
133 Ga0265760_10013440 3300031090 Bacteria 2343
134 Ga0265325_10003919 3300031241 Bacteria 9530
135 Ga0265339_10032680 3300031249 Bacteria 2934
136 Ga0265339_10053455 3300031249 Unclassified 2197
137 Ga0265314_10017964 3300031711 Bacteria 5534
138 Ga0373923_0079101 3300035111 Bacteria 1424
139 Ga0373936_0006256 3300035113 Bacteria 4490
140 Ga0373924_0001718 3300035410 Bacteria 7234
141 Ga0373935_0009713 3300035692 Bacteria 5761
142 Ga0373933_0264969 3300035724 Bacteria 1108
143 Ga0373937_0010493 3300036401 Bacteria 8090
144 Ga0373937_0283429 3300036401 Bacteria 1565
145 Ga0373937_0285020 3300036401 Bacteria 1560
146 Ga0436362_0226101 3300039453 Bacteria 2658
147 Ga0451576_1114213 3300045051 Bacteria 826
148 Ga0466967_0038113 3300045976 Bacteria 4120
149 Ga0466967_0347614 3300045976 Bacteria 1435
150 Ga0495651_0308979 3300046462 Bacteria 1058
151 Ga0495580_0003225 3300046472 Bacteria 13957
152 Ga0495580_0004931 3300046472 Bacteria 11155
153 Ga0495580_0018653 3300046472 Bacteria 5163
154 Ga0495664_0071311 3300046477 Bacteria 2075
155 Ga0495664_0374301 3300046477 Bacteria 857
156 Ga0495628_0207424 3300046516 Bacteria 1475
157 Ga0495628_0211188 3300046516 Bacteria 1460
158 Ga0495630_0071324 3300046517 Bacteria 2614
159 Ga0495659_0178012 3300046664 Unclassified 865
160 Ga0495604_0080866 3300047317 Bacteria 2434
161 Ga0495674_0065535 3300047319 Bacteria 3155
162 Ga0495674_0069709 3300047319 Bacteria 3040
163 Ga0496101_0226609 3300048904 Unclassified 1452
164 Ga0496102_0046059 3300048905 Bacteria 3960
165 Ga0496103_0105905 3300048906 Bacteria 1783
166 Ga0496104_0134200 3300048907 Bacteria 2378
167 Ga0496107_0064753 3300048910 Bacteria 2650
168 Ga0496111_0084620 3300048914 Bacteria 2318
169 Ga0496112_0004403 3300048915 Bacteria 11915
170 Ga0496115_0120047 3300048918 Bacteria 2162
171 nmdc:mga06r32_37147_c1 3300050510 Bacteria 4607
172 nmdc:mga08x19_122349_c1 3300050514 Bacteria 1745
173 nmdc:mga08x19_3308_c1 3300050514 Bacteria 9632
174 Ga0501082_0004406 3300060353 Bacteria 12294
175 Ga0265770_1009877
176 MBSR1b_contig_831446
177 LJNas_1000712
178 JGI24752J21851_1000691
179 Ga0065712_10123379
180 Ga0065715_10091077
181 Ga0070658_10105845
182 Ga0070690_100008269
183 Ga0068869_100007756
184 Ga0070666_10019520
185 Ga0070680_100196817
186 Ga0070682_100020375
187 Ga0068868_100001727
188 Ga0068868_100013441
189 Ga0070660_100008269
190 Ga0070687_100000859
191 Ga0070675_100013076
192 Ga0070671_100019576
193 Ga0070659_100006119
194 Ga0070667_100037279
195 Ga0070667_100065392
196 Ga0070667_100137980
197 Ga0070714_100003325
198 Ga0070714_100046773
199 Ga0070713_100016431
200 Ga0070713_100029597
201 Ga0070710_10000881
202 Ga0070710_10050656
203 Ga0070710_10084706
204 Ga0070701_10017230
205 Ga0070711_100004478
206 Ga0070700_100049186
207 Ga0070708_100152558
208 Ga0070708_100639054
209 Ga0070678_100006009
210 Ga0070662_100149948
211 Ga0070707_100308962
212 Ga0070699_100089687
213 Ga0070697_100614484
214 Ga0070693_100022302
215 Ga0070665_100121439
216 Ga0068854_100009804
217 Ga0070702_100005603
218 Ga0068859_100007183
219 Ga0068866_10163221
220 Ga0068861_100220062
221 Ga0068858_100015804
222 Ga0068860_100024974
223 Ga0068862_100097899
224 Ga0070717_10001393
225 Ga0070717_10001889
226 Ga0070717_10035429
227 Ga0070717_10512672
228 Ga0070715_10003144
229 Ga0070712_100003020
230 Ga0070712_100237975
231 Ga0097621_100001455
232 Ga0068871_100002024
233 Ga0068871_100194991
234 Ga0075428_100022921
235 Ga0075431_100059777
236 Ga0075436_100156634
237 Ga0097620_100007183
238 Ga0099794_10065216
239 Ga0105240_10096230
240 Ga0105245_10003969
241 Ga0105241_10283847
242 Ga0105242_10138240
243 Ga0105242_10223466
244 Ga0105248_10157816
245 Ga0105248_10709915
246 Ga0105237_10088180
247 Ga0105237_10229173
248 Ga0099796_10035195
249 Ga0105239_10043303
250 Ga0105239_10186677
251 Ga0105239_10341370
252 Ga0157373_10062406
253 Ga0157369_10162262
254 Ga0157369_10632418
255 Ga0157374_10157642
256 Ga0157374_10222613
257 Ga0157378_10001149
258 Ga0157378_10095794
259 Ga0163162_10013096
260 Ga0163162_10312843
261 Ga0163162_10632656
262 Ga0157372_10110965
263 Ga0157375_10010099
264 Ga0157375_10126322
265 Ga0163163_10000850
266 Ga0163163_10331728
267 Ga0182008_10083198
268 Ga0157377_10000535
269 Ga0157376_10271789
270 Ga0157376_10413671
271 Ga0228598_1000687
272 Ga0207656_10143637
273 Ga0207692_10006197
274 Ga0207642_10125986
275 Ga0207685_10037310
276 Ga0207684_10002533
277 Ga0207693_10000038
278 Ga0207663_10003648
279 Ga0207646_10002290
280 Ga0207646_10310135
281 Ga0207700_10001212
282 Ga0207664_10010642
283 Ga0207706_10207922
284 Ga0207704_10103923
285 Ga0207665_10017505
286 Ga0207711_10670878
287 Ga0207689_10021351
288 Ga0207661_10273187
289 Ga0207667_10141637
290 Ga0207640_10503181
291 Ga0207703_10001482
292 Ga0207703_10666351
293 Ga0207639_10219737
294 Ga0207641_10383925
295 Ga0207641_11003943
296 Ga0265356_1000309
297 Ga0265356_1003783
298 Ga0268265_10014605
299 Ga0265338_10015603
300 Ga0265338_10081914
301 Ga0265338_10121027
302 Ga0265762_1000635
303 Ga0265762_1001637
304 Ga0265760_10000193
305 Ga0265760_10006221
306 Ga0265760_10008091
307 Ga0265760_10013440
308 Ga0265325_10003919
309 Ga0265339_10032680
310 Ga0265339_10053455
311 Ga0265314_10017964
312 Ga0373923_0079101
313 Ga0373936_0006256
314 Ga0373924_0001718
315 Ga0373935_0009713
316 Ga0373933_0264969
317 Ga0373937_0010493
318 Ga0373937_0283429
319 Ga0373937_0285020
320 Ga0436362_0226101
321 Ga0451576_1114213
322 Ga0466967_0038113
323 Ga0466967_0347614
324 Ga0495651_0308979
325 Ga0495580_0003225
326 Ga0495580_0004931
327 Ga0495580_0018653
328 Ga0495664_0071311
329 Ga0495664_0374301
330 Ga0495628_0207424
331 Ga0495628_0211188
332 Ga0495630_0071324
333 Ga0495659_0178012
334 Ga0495604_0080866
335 Ga0495674_0065535
336 Ga0495674_0069709
337 Ga0496101_0226609
338 Ga0496102_0046059
339 Ga0496103_0105905
340 Ga0496104_0134200
341 Ga0496107_0064753
342 Ga0496111_0084620
343 Ga0496112_0004403
344 Ga0496115_0120047
345 nmdc:mga06r32_37147_c1
346 nmdc:mga08x19_122349_c1
347 nmdc:mga08x19_3308_c1
348 Ga0501082_0004406

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03781

FGE-sulfatase

Sulfatase-modifying factor enzyme 1

40

264

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7spq-assembly1.cif.gz_A-2 crystal structure of burkholderia glumae toxoflavin biosynthesis protein toxd 0.7238 13 238
6muj-assembly1.cif.gz_A formylglycine generating enzyme bound to copper 0.7177 15 238
5nxl-assembly1.cif.gz_A formylglycine generating enzyme from t. curvata in complex with ag(i) 0.7176 12 238
2afy-assembly1.cif.gz_X formylglycine generating enzyme c341s mutant 0.7127 11 238
2hib-assembly1.cif.gz_X human formylglycine generating enzyme, c336s mutant, iodide co-crystallization 0.7127 14 238
ID Description Score Start End Superfamily
af_A0A2R8Q5G7_74_369_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.6828 1 238 3.90.1580.10
af_A0A2R8Q5G7_74_369_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.6801 1 238 3.90.1580.10
af_O69671_154_424_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.6591 10 237 3.90.1580.10
af_Q8NBJ7_27_294_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.6566 15 238 3.90.1580.10
af_I6Y8I5_2_297_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.6528 13 238 3.90.1580.10
ID Description Score Start End GO Terms
AF-A0A6L8DQT1-F1-model_v4 Formylglycine-generating enzyme family protein 0.9804 13 126 GO:0120147
AF-A0A800JZB1-F1-model_v4 Sulfatase-modifying factor enzyme domain-containing protein 0.975 6 124 GO:0120147
AF-A0A2E1W2V0-F1-model_v4 Sulfatase-modifying factor enzyme domain-containing protein 0.9744 13 133 GO:0120147
AF-A0A355B7I1-F1-model_v4 Sulfatase-modifying factor enzyme domain-containing protein 0.9611 15 117
AF-A0A382RB71-F1-model_v4 Sulfatase-modifying factor enzyme domain-containing protein 0.9606 10 135 GO:0120147

Map