F264009

General Info

Members Datasets Scaffolds Average Seq Length
174 123 348 55

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10033567|Ga0070709_100335674
Length 53
Sequence MGRQIAVALYVLAMVAAIVGLDLMFFRNQERLMVNIDFVLVFASFYLRFLKPS

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
43 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
45 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
46 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
47 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
71 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
74 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
75 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
76 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
77 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
78 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
79 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
80 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
81 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
82 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
90 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
91 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
92 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
93 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
94 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
95 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
96 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
97 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
100 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
101 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
102 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
103 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
104 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
105 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
108 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
109 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
114 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
117 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
118 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
119 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
120 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
121 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
122 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
123 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.7
Metatranscriptomes 2.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.15
Rhizosphere 94.25
Stem 0
Stem Tuber 0
Unclassified 29.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10033567 3300005434 Bacteria 3105
2 Ga0070682_100529696 3300005337 Bacteria 918
3 Ga0070689_100785098 3300005340 Unclassified 837
4 Ga0070709_11610882 3300005434 Unclassified 529
5 Ga0070714_101662320 3300005435 Unclassified 624
6 Ga0070713_100039649 3300005436 Unclassified 3824
7 Ga0070713_100098248 3300005436 Bacteria 2531
8 Ga0070713_100494091 3300005436 Bacteria 1154
9 Ga0070713_101332296 3300005436 Unclassified 696
10 Ga0070713_101543671 3300005436 Unclassified 644
11 Ga0070710_10040606 3300005437 Bacteria 2565
12 Ga0070710_10729005 3300005437 Unclassified 702
13 Ga0070711_100071362 3300005439 Unclassified 2447
14 Ga0070711_100207183 3300005439 Unclassified 1516
15 Ga0070681_10757162 3300005458 Bacteria 888
16 Ga0070706_100159013 3300005467 Bacteria 2109
17 Ga0070706_100737808 3300005467 Unclassified 913
18 Ga0070698_100091889 3300005471 Bacteria 3017
19 Ga0070679_101581043 3300005530 Bacteria 603
20 Ga0068853_101354013 3300005539 Bacteria 688
21 Ga0070696_101213542 3300005546 Unclassified 638
22 Ga0070696_101464802 3300005546 Unclassified 584
23 Ga0068855_100012188 3300005563 Bacteria 10389
24 Ga0068855_100298982 3300005563 Unclassified 1783
25 Ga0068856_100163770 3300005614 Bacteria 2235
26 Ga0068856_101264083 3300005614 Bacteria 754
27 Ga0068856_102058937 3300005614 Unclassified 581
28 Ga0081455_10737292 3300005937 Bacteria 624
29 Ga0081540_1059454 3300005983 Bacteria 1835
30 Ga0070717_10256366 3300006028 Bacteria 1547
31 Ga0070717_10637437 3300006028 Bacteria 967
32 Ga0070715_10154197 3300006163 Unclassified 1129
33 Ga0070716_100071123 3300006173 Bacteria 2045
34 Ga0070712_100083113 3300006175 Bacteria 2324
35 Ga0070712_100223623 3300006175 Unclassified 1491
36 Ga0075428_100109825 3300006844 Bacteria 3004
37 Ga0075430_100154989 3300006846 Bacteria 1907
38 Ga0075431_100073268 3300006847 Bacteria 3533
39 Ga0075433_10045991 3300006852 Bacteria 3795
40 Ga0075433_10130098 3300006852 Bacteria 2236
41 Ga0075434_100027365 3300006871 Bacteria 5598
42 Ga0075434_101744307 3300006871 Unclassified 630
43 Ga0075429_100052873 3300006880 Bacteria 3533
44 Ga0075436_100459861 3300006914 Bacteria 927
45 Ga0075435_100148545 3300007076 Bacteria 1969
46 Ga0099794_10745780 3300007265 Bacteria 523
47 Ga0111539_10019768 3300009094 Bacteria 8306
48 Ga0111539_13358453 3300009094 Unclassified 515
49 Ga0114129_10983271 3300009147 Bacteria 1064
50 Ga0114129_12229864 3300009147 Bacteria 658
51 Ga0105237_10007625 3300009545 Bacteria 11828
52 Ga0105249_10072696 3300009553 Bacteria 3179
53 Ga0105239_11662420 3300010375 Unclassified 739
54 Ga0157371_10631489 3300013102 Bacteria 798
55 Ga0157370_10129557 3300013104 Unclassified 2354
56 Ga0157369_10119836 3300013105 Unclassified 2792
57 Ga0157369_10124789 3300013105 Bacteria 2731
58 Ga0157369_11167619 3300013105 Bacteria 786
59 Ga0157374_10063984 3300013296 Bacteria 3450
60 Ga0157372_10341765 3300013307 Unclassified 1743
61 Ga0157372_12042551 3300013307 Bacteria 659
62 Ga0157375_10812717 3300013308 Bacteria 1083
63 Ga0182007_10003420 3300015262 Bacteria 7479
64 Ga0206350_10574643 3300020080 Bacteria 610
65 Ga0154015_1175442 3300020610 Bacteria 1188
66 Ga0213873_10108937 3300021358 Unclassified 803
67 Ga0213875_10136330 3300021388 Unclassified 1148
68 Ga0207692_10037489 3300025898 Unclassified 2371
69 Ga0207692_10311066 3300025898 Unclassified 961
70 Ga0207692_10597395 3300025898 Bacteria 709
71 Ga0207692_10742947 3300025898 Unclassified 639
72 Ga0207685_10120583 3300025905 Unclassified 1151
73 Ga0207699_10027977 3300025906 Bacteria 3128
74 Ga0207699_10544586 3300025906 Bacteria 841
75 Ga0207705_10432392 3300025909 Bacteria 1020
76 Ga0207684_10182423 3300025910 Bacteria 1810
77 Ga0207684_10193433 3300025910 Bacteria 1754
78 Ga0207707_10925374 3300025912 Bacteria 719
79 Ga0207671_10000468 3300025914 Bacteria 55019
80 Ga0207693_10052358 3300025915 Bacteria 3202
81 Ga0207693_10414883 3300025915 Bacteria 1052
82 Ga0207693_10431481 3300025915 Bacteria 1030
83 Ga0207663_10486217 3300025916 Unclassified 957
84 Ga0207663_11046579 3300025916 Unclassified 655
85 Ga0207663_11213955 3300025916 Bacteria 607
86 Ga0207657_10959662 3300025919 Unclassified 657
87 Ga0207652_10097718 3300025921 Bacteria 2589
88 Ga0207652_10241392 3300025921 Bacteria 1629
89 Ga0207700_10000349 3300025928 Bacteria 27026
90 Ga0207700_10055284 3300025928 Bacteria 2983
91 Ga0207700_10069991 3300025928 Bacteria 2695
92 Ga0207700_10950554 3300025928 Bacteria 769
93 Ga0207700_11713526 3300025928 Bacteria 554
94 Ga0207700_11941901 3300025928 Unclassified 515
95 Ga0207664_10425489 3300025929 Bacteria 1183
96 Ga0207664_10435360 3300025929 Bacteria 1169
97 Ga0207665_10020228 3300025939 Bacteria 4372
98 Ga0207665_11443084 3300025939 Unclassified 547
99 Ga0207667_10022066 3300025949 Bacteria 7044
100 Ga0207667_10665052 3300025949 Unclassified 1046
101 Ga0207698_10024250 3300026142 Bacteria 4255
102 Ga0207428_10034236 3300027907 Bacteria 4165
103 Ga0265323_10138633 3300028653 Bacteria 784
104 Ga0265338_10151648 3300028800 Bacteria 1800
105 Ga0265338_10275926 3300028800 Bacteria 1230
106 Ga0265762_1180147 3300030760 Unclassified 520
107 Ga0265770_1070495 3300030878 Unclassified 666
108 Ga0265330_10509215 3300031235 Unclassified 513
109 Ga0265325_10071723 3300031241 Bacteria 1737
110 Ga0265340_10015034 3300031247 Bacteria 4030
111 Ga0265313_10342985 3300031595 Unclassified 593
112 Ga0265314_10115253 3300031711 Bacteria 1701
113 Ga0265342_10085008 3300031712 Bacteria 1821
114 Ga0316577_10137830 3300031733 Bacteria 1374
115 Ga0373934_0095850 3300035086 Bacteria 1198
116 Ga0373951_0067702 3300035091 Bacteria 905
117 Ga0373945_0233381 3300035116 Bacteria 773
118 Ga0373954_0538782 3300035118 Unclassified 578
119 Ga0373943_0260052 3300035170 Bacteria 977
120 Ga0373946_0410160 3300035171 Unclassified 685
121 Ga0373955_0112561 3300035172 Bacteria 1575
122 Ga0373935_0130199 3300035692 Bacteria 1690
123 Ga0373927_0395217 3300035695 Bacteria 912
124 Ga0373937_0012419 3300036401 Bacteria 7491
125 Ga0373937_0196452 3300036401 Unclassified 1896
126 Ga0373937_0362864 3300036401 Unclassified 1373
127 Ga0373925_0532046 3300037068 Bacteria 966
128 Ga0395900_0312023 3300037418 Bacteria 1556
129 Ga0436364_0444778 3300037853 Unclassified 1717
130 Ga0436365_0550939 3300039437 Bacteria 1685
131 Ga0436365_0583760 3300039437 Bacteria 523
132 Ga0436360_0114362 3300039438 Bacteria 787
133 Ga0436360_0900557 3300039438 Bacteria 709
134 Ga0436361_1134377 3300039447 Bacteria 904
135 Ga0436363_0090391 3300039450 Bacteria 838
136 Ga0436363_0247245 3300039450 Bacteria 569
137 Ga0436363_0711208 3300039450 Unclassified 620
138 Ga0436363_1710782 3300039450 Bacteria 565
139 Ga0436362_0322287 3300039453 Unclassified 788
140 Ga0453683_0619984 3300044673 Bacteria 706
141 Ga0466963_0590160 3300044694 Unclassified 785
142 Ga0495592_0567528 3300046454 Unclassified 696
143 Ga0495629_0507558 3300046459 Bacteria 813
144 Ga0495628_0000148 3300046516 Bacteria 60692
145 Ga0495628_0610318 3300046516 Unclassified 778
146 Ga0495652_1054570 3300046529 Bacteria 529
147 Ga0495665_0075700 3300046531 Bacteria 1772
148 Ga0495640_0048104 3300046533 Bacteria 2949
149 Ga0495645_0049209 3300046543 Bacteria 3070
150 Ga0495645_0212364 3300046543 Bacteria 1306
151 Ga0495634_0200746 3300046642 Unclassified 1239
152 Ga0495635_0853037 3300046663 Bacteria 585
153 Ga0495623_0045437 3300046679 Bacteria 2790
154 Ga0495624_0218779 3300046690 Bacteria 1155
155 Ga0495674_0052290 3300047319 Bacteria 3595
156 Ga0495676_0331330 3300047321 Bacteria 1021
157 Ga0495684_0521224 3300047471 Bacteria 814
158 Ga0495602_0432147 3300048088 Bacteria 933
159 Ga0496109_0460301 3300048912 Bacteria 1201
160 Ga0496110_1449524 3300048913 Bacteria 596
161 Ga0501034_0113665 3300049571 Unclassified 2697
162 Ga0501070_1236678 3300049586 Unclassified 572
163 Ga0501035_0274449 3300049822 Bacteria 1426
164 nmdc:mga05p37_19736_c1 3300050507 Bacteria 3787
165 nmdc:mga0qj67_130230_c1 3300050509 Bacteria 2038
166 nmdc:mga06r32_1954658_c1 3300050510 Bacteria 521
167 nmdc:mga08y16_25894_c1 3300050511 Bacteria 6189
168 nmdc:mga0n895_21976_c1 3300050512 Bacteria 5977
169 nmdc:mga08x19_1124473_c1 3300050514 Bacteria 557
170 nmdc:mga0a205_16479_c1 3300050515 Bacteria 6920
171 Ga0495601_0356630 3300053077 Bacteria 950
172 Ga0495601_0406246 3300053077 Bacteria 883
173 Ga0495601_0761293 3300053077 Unclassified 616
174 Ga0495619_0468234 3300053085 Bacteria 868
175 Ga0070709_10033567
176 Ga0070682_100529696
177 Ga0070689_100785098
178 Ga0070709_11610882
179 Ga0070714_101662320
180 Ga0070713_100039649
181 Ga0070713_100098248
182 Ga0070713_100494091
183 Ga0070713_101332296
184 Ga0070713_101543671
185 Ga0070710_10040606
186 Ga0070710_10729005
187 Ga0070711_100071362
188 Ga0070711_100207183
189 Ga0070681_10757162
190 Ga0070706_100159013
191 Ga0070706_100737808
192 Ga0070698_100091889
193 Ga0070679_101581043
194 Ga0068853_101354013
195 Ga0070696_101213542
196 Ga0070696_101464802
197 Ga0068855_100012188
198 Ga0068855_100298982
199 Ga0068856_100163770
200 Ga0068856_101264083
201 Ga0068856_102058937
202 Ga0081455_10737292
203 Ga0081540_1059454
204 Ga0070717_10256366
205 Ga0070717_10637437
206 Ga0070715_10154197
207 Ga0070716_100071123
208 Ga0070712_100083113
209 Ga0070712_100223623
210 Ga0075428_100109825
211 Ga0075430_100154989
212 Ga0075431_100073268
213 Ga0075433_10045991
214 Ga0075433_10130098
215 Ga0075434_100027365
216 Ga0075434_101744307
217 Ga0075429_100052873
218 Ga0075436_100459861
219 Ga0075435_100148545
220 Ga0099794_10745780
221 Ga0111539_10019768
222 Ga0111539_13358453
223 Ga0114129_10983271
224 Ga0114129_12229864
225 Ga0105237_10007625
226 Ga0105249_10072696
227 Ga0105239_11662420
228 Ga0157371_10631489
229 Ga0157370_10129557
230 Ga0157369_10119836
231 Ga0157369_10124789
232 Ga0157369_11167619
233 Ga0157374_10063984
234 Ga0157372_10341765
235 Ga0157372_12042551
236 Ga0157375_10812717
237 Ga0182007_10003420
238 Ga0206350_10574643
239 Ga0154015_1175442
240 Ga0213873_10108937
241 Ga0213875_10136330
242 Ga0207692_10037489
243 Ga0207692_10311066
244 Ga0207692_10597395
245 Ga0207692_10742947
246 Ga0207685_10120583
247 Ga0207699_10027977
248 Ga0207699_10544586
249 Ga0207705_10432392
250 Ga0207684_10182423
251 Ga0207684_10193433
252 Ga0207707_10925374
253 Ga0207671_10000468
254 Ga0207693_10052358
255 Ga0207693_10414883
256 Ga0207693_10431481
257 Ga0207663_10486217
258 Ga0207663_11046579
259 Ga0207663_11213955
260 Ga0207657_10959662
261 Ga0207652_10097718
262 Ga0207652_10241392
263 Ga0207700_10000349
264 Ga0207700_10055284
265 Ga0207700_10069991
266 Ga0207700_10950554
267 Ga0207700_11713526
268 Ga0207700_11941901
269 Ga0207664_10425489
270 Ga0207664_10435360
271 Ga0207665_10020228
272 Ga0207665_11443084
273 Ga0207667_10022066
274 Ga0207667_10665052
275 Ga0207698_10024250
276 Ga0207428_10034236
277 Ga0265323_10138633
278 Ga0265338_10151648
279 Ga0265338_10275926
280 Ga0265762_1180147
281 Ga0265770_1070495
282 Ga0265330_10509215
283 Ga0265325_10071723
284 Ga0265340_10015034
285 Ga0265313_10342985
286 Ga0265314_10115253
287 Ga0265342_10085008
288 Ga0316577_10137830
289 Ga0373934_0095850
290 Ga0373951_0067702
291 Ga0373945_0233381
292 Ga0373954_0538782
293 Ga0373943_0260052
294 Ga0373946_0410160
295 Ga0373955_0112561
296 Ga0373935_0130199
297 Ga0373927_0395217
298 Ga0373937_0012419
299 Ga0373937_0196452
300 Ga0373937_0362864
301 Ga0373925_0532046
302 Ga0395900_0312023
303 Ga0436364_0444778
304 Ga0436365_0550939
305 Ga0436365_0583760
306 Ga0436360_0114362
307 Ga0436360_0900557
308 Ga0436361_1134377
309 Ga0436363_0090391
310 Ga0436363_0247245
311 Ga0436363_0711208
312 Ga0436363_1710782
313 Ga0436362_0322287
314 Ga0453683_0619984
315 Ga0466963_0590160
316 Ga0495592_0567528
317 Ga0495629_0507558
318 Ga0495628_0000148
319 Ga0495628_0610318
320 Ga0495652_1054570
321 Ga0495665_0075700
322 Ga0495640_0048104
323 Ga0495645_0049209
324 Ga0495645_0212364
325 Ga0495634_0200746
326 Ga0495635_0853037
327 Ga0495623_0045437
328 Ga0495624_0218779
329 Ga0495674_0052290
330 Ga0495676_0331330
331 Ga0495684_0521224
332 Ga0495602_0432147
333 Ga0496109_0460301
334 Ga0496110_1449524
335 Ga0501034_0113665
336 Ga0501070_1236678
337 Ga0501035_0274449
338 nmdc:mga05p37_19736_c1
339 nmdc:mga0qj67_130230_c1
340 nmdc:mga06r32_1954658_c1
341 nmdc:mga08y16_25894_c1
342 nmdc:mga0n895_21976_c1
343 nmdc:mga08x19_1124473_c1
344 nmdc:mga0a205_16479_c1
345 Ga0495601_0356630
346 Ga0495601_0406246
347 Ga0495601_0761293
348 Ga0495619_0468234

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map