F263326

General Info

Members Datasets Scaffolds Average Seq Length
173 137 346 285

Family's Representative Sequence

Representative Sequence 3300048913|Ga0496110_0114336|Ga0496110_0114336_1267_2226
Length 319
Sequence VDFVDELNICTMVSNAFVEGIFPVQWKSQRRGAQMTKMRVTAVQYHLHTIQSFAEFAAQVEHYVKAAEEFGADFVLFPEFFTTQLMSIGKDGRALRIDELPEYTEQYLELFTGLAKQTGMHLIGGTHVVEKAGKLYNTAHLFYPDGRVATQAKLHITPTEVHEWNMAAGESFEVFETEKGKVALLTCYDIEFPEIVRIAKARGADVVFCPSCTDDRHGFHRVRYTSHARAVENQIYVVLTGTVGSLPTVDFMRANFGQAAVITPNDIPFPPQGLAAEGEINDDMIITADLDLELLDQVREKGSVTTWRDRRTDLYTDWK

Samples

Sample ID Description Type Environment
1 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
5 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
6 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
7 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
8 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
9 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
10 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
11 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
12 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
13 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
14 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
15 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
16 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
17 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
21 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
22 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
23 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
24 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
25 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
26 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
27 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
28 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
29 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
30 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
31 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
32 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
33 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
34 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
35 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
36 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
37 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
38 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
39 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
40 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
41 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
42 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
43 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
44 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
45 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
46 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
47 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
50 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
51 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
52 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
53 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
54 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
55 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
56 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
57 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
58 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
59 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
60 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
61 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
62 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
63 2671180694 Paenibacillus sp. A3 Isolate Unclassified
64 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
65 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
66 2738541295 Bacillus sp. OK085 Isolate Unclassified
67 2738543010 Bacillus sp. YR335 Isolate Unclassified
68 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
69 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
70 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
71 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
72 2818991441 Niallia circulans 3243 Isolate Rhizosphere
73 2818991459 Paenibacillus sp. 597 Isolate Unclassified
74 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
75 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
76 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
77 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
78 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
79 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
80 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
81 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
82 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
83 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
84 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
85 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
86 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
87 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
88 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
89 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
90 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
91 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
92 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
93 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
94 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
95 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
96 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
97 2919720352 Priestia megaterium 4340 Isolate Unclassified
98 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
99 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
100 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
101 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
102 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
103 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
104 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
105 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
106 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
107 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
108 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
109 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
110 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
111 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
112 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
113 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
114 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
115 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
116 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
117 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
118 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
119 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
120 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
121 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
122 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
123 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
124 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
125 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
126 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
127 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
128 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
129 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
130 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
131 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
132 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
133 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
134 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
135 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
136 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
137 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 47.4
Metatranscriptomes 2.31
Isolates 50.29

Biome Distribution

Category Percentage (%)
Aerial Root 1.16
Bulb 0
Endosphere 12.72
Nodule 1.16
Rhizoplane 2.89
Rhizosphere 45.09
Stem 0
Stem Tuber 0
Unclassified 1.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496110_0114336 3300048913 Bacteria 2428
2 JGI25151J46595_10002468 3300003187 Bacteria 11081
3 JGI25151J46595_10003793 3300003187 Bacteria 8194
4 JGI25151J46595_10017003 3300003187 Bacteria 3167
5 rootH1_10114564 3300003316 Bacteria 1889
6 Ga0055538_1000533 3300003751 Bacteria 13439
7 Ga0055532_1000061 3300003758 Bacteria 149797
8 Ga0055532_1001986 3300003758 Bacteria 4765
9 Ga0055541_1002995 3300003841 Bacteria 3251
10 Ga0105251_10005503 3300009011 Bacteria 8252
11 Ga0105251_10011075 3300009011 Bacteria 5174
12 Ga0105244_10000808 3300009036 Bacteria 26551
13 Ga0105244_10015548 3300009036 Bacteria 4361
14 Ga0105244_10017536 3300009036 Bacteria 4043
15 Ga0105244_10124441 3300009036 Bacteria 1247
16 Ga0105250_10002385 3300009092 Bacteria 9479
17 Ga0105250_10018824 3300009092 Bacteria 2794
18 Ga0105246_10000165 3300011119 Bacteria 31859
19 Ga0209784_100169 3300025224 Bacteria 56390
20 Ga0209784_103271 3300025224 Bacteria 1413
21 Ga0209566_100046 3300025225 Bacteria 247053
22 Ga0209566_100656 3300025225 Bacteria 20820
23 Ga0209147_100020 3300025229 Bacteria 474055
24 Ga0209147_100042 3300025229 Bacteria 301263
25 Ga0209147_108021 3300025229 Bacteria 1336
26 Ga0209437_101105 3300025233 Bacteria 8472
27 Ga0209676_1000398 3300025292 Bacteria 79331
28 Ga0209025_1001690 3300025294 Bacteria 26947
29 Ga0209025_1002716 3300025294 Bacteria 17980
30 Ga0209025_1004582 3300025294 Bacteria 11863
31 Ga0209025_1012630 3300025294 Bacteria 5394
32 Ga0207696_1026432 3300025711 Bacteria 1796
33 Ga0207655_1000073 3300025728 Bacteria 232160
34 Ga0207655_1012367 3300025728 Bacteria 4993
35 Ga0207713_1010340 3300025735 Bacteria 5173
36 Ga0209970_1015619 3300027614 Bacteria 1264
37 Ga0307408_100338521 3300031548 Bacteria 1273
38 Ga0307408_100359196 3300031548 Bacteria 1238
39 Ga0307409_100013792 3300031995 Bacteria 5222
40 Ga0307416_100140805 3300032002 Bacteria 2192
41 Ga0439436_0000601 3300041404 Bacteria 9539
42 Ga0439439_0001555 3300041406 Bacteria 4610
43 Ga0439433_0001768 3300041999 Bacteria 4487
44 Ga0439449_0000030 3300042007 Bacteria 42422
45 Ga0439462_0000042 3300042015 Bacteria 18219
46 Ga0466969_0023524 3300044656 Bacteria 3175
47 Ga0466959_0005469 3300045049 Bacteria 8704
48 Ga0495590_0018107 3300046457 Bacteria 2525
49 Ga0495654_0037540 3300046530 Bacteria 2428
50 Ga0495660_0055157 3300046810 Bacteria 2152
51 Ga0496102_0043313 3300048905 Bacteria 4081
52 Ga0496102_0584130 3300048905 Bacteria 1040
53 Ga0496103_0033781 3300048906 Bacteria 3126
54 Ga0496116_0006350 3300048919 Bacteria 10753
55 Ga0496116_0024761 3300048919 Bacteria 4429
56 Ga0496116_0056844 3300048919 Bacteria 2562
57 Ga0496116_0078405 3300048919 Bacteria 2060
58 Ga0496116_0091669 3300048919 Unclassified 1846
59 Ga0496116_0114558 3300048919 Unclassified 1575
60 Ga0496116_0170144 3300048919 Bacteria 1181
61 Ga0496117_0015476 3300048920 Bacteria 6502
62 Ga0496119_0015211 3300048922 Bacteria 5951
63 Ga0496119_0169792 3300048922 Bacteria 1153
64 Ga0496120_0013240 3300048923 Bacteria 5565
65 Ga0496121_0018495 3300048924 Bacteria 7022
66 Ga0496121_0084305 3300048924 Bacteria 2506
67 Ga0496121_0236275 3300048924 Unclassified 1277
68 Ga0496122_0049801 3300048925 Bacteria 3201
69 Ga0496122_0070383 3300048925 Bacteria 2500
70 Ga0496122_0175973 3300048925 Bacteria 1282
71 Ga0496123_0068513 3300048926 Bacteria 2234
72 Ga0496124_0002040 3300048927 Bacteria 27456
73 Ga0496124_0014423 3300048927 Bacteria 7642
74 Ga0496124_0035526 3300048927 Bacteria 4359
75 Ga0496124_0300591 3300048927 Bacteria 1159
76 Ga0496125_0005987 3300048928 Bacteria 13311
77 Ga0496125_0013714 3300048928 Bacteria 7949
78 Ga0496125_0075593 3300048928 Bacteria 2606
79 Ga0496126_0009224 3300048929 Bacteria 10522
80 Ga0501305_008692 3300049161 Bacteria 1320
81 Ga0501305_009304 3300049161 Bacteria 1289
82 Ga0501312_005378 3300049528 Bacteria 1552
83 Ga0501317_005048 3300049533 Bacteria 1399
84 Ga0501217_011581 3300049661 Bacteria 1953
85 nmdc:mga03n38_159086_c1 3300050490 Bacteria 1142
86 Ga0500642_0010311 3300053130 Bacteria 3289
87 2511177372 2510917027 Bacteria 5287437
88 2512638543 2512564013 Bacteria 6286191
89 2512732740 2512564039 Bacteria 8739048
90 2524186052 2524023129 Bacteria 6762600
91 2550903296 2548877040 Bacteria 7507281
92 2571527432 2571042143 Bacteria 6986194
93 2587743814 2585428059 Bacteria 8696589
94 2595090216 2593339131 Bacteria 5116855
95 2595315282 2593339198 Bacteria 7267884
96 2643740630 2643221543 Bacteria 6628015
97 2644422841 2643221676 Bacteria 8119172
98 2673819686 2671180694 Bacteria 7506943
99 2723602588 2721755693 Bacteria 6126117
100 2728529644 2728368933 Bacteria 7044283
101 2738817243 2738541295 Bacteria 5730091
102 2739233488 2738543010 Bacteria 5583595
103 2757567468 2757320391 Bacteria 4746095
104 2777764146 2775507177 Bacteria 4384303
105 2777837822 2775507192 Bacteria 4622234
106 2793182933 2791355222 Bacteria 5898266
107 2819568179 2818991441 Bacteria 5062707
108 2819674140 2818991459 Bacteria 8736032
109 2821116534 2821111986 Bacteria 6894338
110 2857457562 2857453340 Bacteria 8090534
111 2857461688 2857460504 Bacteria 5194327
112 2857469798 2857465823 Bacteria 6772595
113 2857591866 2857591370 Bacteria 6569758
114 2857604512 2857604169 Bacteria 5111450
115 2857611127 2857609550 Bacteria 3753890
116 2864734606 2864733723 Bacteria 6770668
117 2865001653 2864997549 Bacteria 5139696
118 2865004344 2865002811 Bacteria 6333767
119 2888582465 2888578766 Bacteria 6743310
120 2889048352 2889042446 Bacteria 7618936
121 2889055282 2889049205 Bacteria 7524325
122 2889278557 2889276214 Bacteria 5979355
123 2889296897 2889295896 Bacteria 4704906
124 2898908433 2898907183 Bacteria 4067722
125 2904115518 2904113452 Bacteria 7796941
126 2904494612 2904490793 Bacteria 7046938
127 2904762472 2904755435 Bacteria 7986759
128 2915601199 2915597211 Bacteria 6475886
129 2915607469 2915606848 Bacteria 6032732
130 2919164248 2919160200 Bacteria 6929020
131 2919431838 2919425241 Bacteria 8055701
132 2919725430 2919720352 Bacteria 5986006
133 2929186347 2929183550 Bacteria 6377511
134 2929211999 2929206907 Bacteria 5918291
135 2931385468 2931384279 Bacteria 7299545
136 2936343818 2936340661 Bacteria 5139038
137 2938653973 2938649242 Bacteria 7118381
138 2939680359 2939679117 Bacteria 6921672
139 2939703924 2939702853 Bacteria 5139229
140 2945995895 2945991243 Bacteria 7008369
141 2946058597 2946053406 Bacteria 6978655
142 2956897987 2956897341 Bacteria 5447711
143 2964377408 2964375228 Bacteria 4909004
144 2968562909 2968558590 Bacteria 6956864
145 2971407588 2971403814 Bacteria 7370929
146 2971410607 2971410472 Bacteria 8311090
147 2977258153 2977254563 Bacteria 4828420
148 2980127794 2980125574 Bacteria 5567337
149 2980183232 2980182181 Bacteria 9454109
150 2981285371 2981284811 Bacteria 4641497
151 2981290317 2981289755 Bacteria 4641509
152 2981981054 2981980479 Bacteria 4641628
153 2981985941 2981985349 Bacteria 4641497
154 2984532455 2984527788 Bacteria 5288478
155 2984533713 2984532647 Bacteria 5288506
156 2988230414 2988225383 Bacteria 7221625
157 2990279161 2990275345 Bacteria 4887158
158 2996637474 2996632988 Bacteria 6921523
159 2996709935 2996706504 Bacteria 5757485
160 3001895449 3001892409 Bacteria 6328293
161 3001898364 3001892409 Bacteria 6328293
162 3006969812 3006969106 Bacteria 4739423
163 3006983791 3006978542 Bacteria 5328100
164 3006990319 3006988479 Bacteria 4767936
165 8002319644 8002317523 Bacteria 8051857
166 8022918801 8022914991 Bacteria 5584517
167 8054469460 8054465665 Bacteria 7323556
168 8054800065 8054795415 Bacteria 9785225
169 8056537342 8056533031 Bacteria 8964429
170 8057474638 8057473075 Bacteria 5892720
171 8057634897 8057632132 Bacteria 4726859
172 8057737973 8057733483 Bacteria 6578323
173 8057979987 8057977335 Bacteria 5694872
174 Ga0496110_0114336
175 JGI25151J46595_10002468
176 JGI25151J46595_10003793
177 JGI25151J46595_10017003
178 rootH1_10114564
179 Ga0055538_1000533
180 Ga0055532_1000061
181 Ga0055532_1001986
182 Ga0055541_1002995
183 Ga0105251_10005503
184 Ga0105251_10011075
185 Ga0105244_10000808
186 Ga0105244_10015548
187 Ga0105244_10017536
188 Ga0105244_10124441
189 Ga0105250_10002385
190 Ga0105250_10018824
191 Ga0105246_10000165
192 Ga0209784_100169
193 Ga0209784_103271
194 Ga0209566_100046
195 Ga0209566_100656
196 Ga0209147_100020
197 Ga0209147_100042
198 Ga0209147_108021
199 Ga0209437_101105
200 Ga0209676_1000398
201 Ga0209025_1001690
202 Ga0209025_1002716
203 Ga0209025_1004582
204 Ga0209025_1012630
205 Ga0207696_1026432
206 Ga0207655_1000073
207 Ga0207655_1012367
208 Ga0207713_1010340
209 Ga0209970_1015619
210 Ga0307408_100338521
211 Ga0307408_100359196
212 Ga0307409_100013792
213 Ga0307416_100140805
214 Ga0439436_0000601
215 Ga0439439_0001555
216 Ga0439433_0001768
217 Ga0439449_0000030
218 Ga0439462_0000042
219 Ga0466969_0023524
220 Ga0466959_0005469
221 Ga0495590_0018107
222 Ga0495654_0037540
223 Ga0495660_0055157
224 Ga0496102_0043313
225 Ga0496102_0584130
226 Ga0496103_0033781
227 Ga0496116_0006350
228 Ga0496116_0024761
229 Ga0496116_0056844
230 Ga0496116_0078405
231 Ga0496116_0091669
232 Ga0496116_0114558
233 Ga0496116_0170144
234 Ga0496117_0015476
235 Ga0496119_0015211
236 Ga0496119_0169792
237 Ga0496120_0013240
238 Ga0496121_0018495
239 Ga0496121_0084305
240 Ga0496121_0236275
241 Ga0496122_0049801
242 Ga0496122_0070383
243 Ga0496122_0175973
244 Ga0496123_0068513
245 Ga0496124_0002040
246 Ga0496124_0014423
247 Ga0496124_0035526
248 Ga0496124_0300591
249 Ga0496125_0005987
250 Ga0496125_0013714
251 Ga0496125_0075593
252 Ga0496126_0009224
253 Ga0501305_008692
254 Ga0501305_009304
255 Ga0501312_005378
256 Ga0501317_005048
257 Ga0501217_011581
258 nmdc:mga03n38_159086_c1
259 Ga0500642_0010311
260 2511177372
261 2512638543
262 2512732740
263 2524186052
264 2550903296
265 2571527432
266 2587743814
267 2595090216
268 2595315282
269 2643740630
270 2644422841
271 2673819686
272 2723602588
273 2728529644
274 2738817243
275 2739233488
276 2757567468
277 2777764146
278 2777837822
279 2793182933
280 2819568179
281 2819674140
282 2821116534
283 2857457562
284 2857461688
285 2857469798
286 2857591866
287 2857604512
288 2857611127
289 2864734606
290 2865001653
291 2865004344
292 2888582465
293 2889048352
294 2889055282
295 2889278557
296 2889296897
297 2898908433
298 2904115518
299 2904494612
300 2904762472
301 2915601199
302 2915607469
303 2919164248
304 2919431838
305 2919725430
306 2929186347
307 2929211999
308 2931385468
309 2936343818
310 2938653973
311 2939680359
312 2939703924
313 2945995895
314 2946058597
315 2956897987
316 2964377408
317 2968562909
318 2971407588
319 2971410607
320 2977258153
321 2980127794
322 2980183232
323 2981285371
324 2981290317
325 2981981054
326 2981985941
327 2984532455
328 2984533713
329 2988230414
330 2990279161
331 2996637474
332 2996709935
333 3001895449
334 3001898364
335 3006969812
336 3006983791
337 3006990319
338 8002319644
339 8022918801
340 8054469460
341 8054800065
342 8056537342
343 8057474638
344 8057634897
345 8057737973
346 8057979987

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

39

300

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ovg-assembly1.cif.gz_B the c146a variant of an amidase from pyrococcus horikoshii with bound acetamide 0.8688 1 262
3iw3-assembly1.cif.gz_B crystal structure of hyperthermophilic nitrilase 0.8646 3 261
2e11-assembly2.cif.gz_D the crystal structure of xc1258 from xanthomonas campestris: a cn-hydrolase superfamily protein with an arsenic adduct in the active site 0.8521 1 267
5h8j-assembly1.cif.gz_H crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine 0.8419 2 281
1j31-assembly2.cif.gz_D crystal structure of hypothetical protein ph0642 from pyrococcus horikoshii 0.8409 3 262
ID Description Score Start End Superfamily
af_P0DP64_2_182_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.8617 86 267 3.60.110.10
af_Q47679_3_256_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.8584 3 275 3.60.110.10
2e11D00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.8521 1 267 3.60.110.10
af_Q94JV5_26_305_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.846 2 270 3.60.110.10
5h8jH00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.8419 2 281 3.60.110.10
ID Description Score Start End GO Terms
AF-A0A2N0QJV9-F1-model_v4 Carbon-nitrogen hydrolase 0.9979 3 126 GO:0016787
AF-A0A2N8GT69-F1-model_v4 deleted 0.9933 88 195
AF-A0A0B0HJF6-F1-model_v4 deleted 0.9911 1 177
AF-A0A2N8GT69-F1-model_v4 deleted 0.9754 88 195
AF-A0A7Y0XA54-F1-model_v4 Hydrolase 0.9753 77 173 GO:0016787

Map