F263128

General Info

Members Datasets Scaffolds Average Seq Length
173 95 346 274

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0086583|Ga0466963_0086583_814_1704
Length 296
Sequence VSDVEESAGDAETVAPDPEAERARMAEHWEQAAAGWGRCADVVRDSGMPASQWLIEHLDLQPGETLLELAAGPGDTGFMAAELIQPGGALISSDGSEPMIEVARGRAAKLGVPNVEFKQLQLEWIDLETATVDAVICRWGIMLTVDPAAAAREIRRVLRPGGRATLAVWDSPEVNPWATTPTRAMIELGHSEPPDPNAPGMFSLAEPGKLQSLLEEAGFTDVVTDAVAVPRDYDSLDHYLDEIGSLSGMFARAMAALTPEQRAEVKARMAEIATPFTDDDGSIHFAGRTLVALARA

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
11 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
12 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
13 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
22 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
23 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
24 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
25 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
26 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
27 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
28 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
42 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
43 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
44 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
45 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
46 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
47 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
48 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
49 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
50 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
51 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
52 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
53 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
54 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
55 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
56 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
57 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
58 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
59 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
60 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
61 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
62 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
63 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
64 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
65 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
66 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
67 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
68 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
69 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
78 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
79 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
80 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
81 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
82 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
83 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
84 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
85 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
86 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
87 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
90 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
91 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
92 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
93 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
94 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
95 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 1.73
Rhizosphere 89.02
Stem 0
Stem Tuber 0
Unclassified 5.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0086583 3300044694 Bacteria 2129
2 Ga0070692_10186070 3300005345 Bacteria 1207
3 Ga0070692_10199447 3300005345 Bacteria 1171
4 Ga0070692_10304004 3300005345 Unclassified 975
5 Ga0070668_100392946 3300005347 Bacteria 1183
6 Ga0070668_100425036 3300005347 Bacteria 1138
7 Ga0070669_100322939 3300005353 Bacteria 1247
8 Ga0070674_100423402 3300005356 Bacteria 1093
9 Ga0070659_100067450 3300005366 Bacteria 2837
10 Ga0070714_100010285 3300005435 Bacteria 7390
11 Ga0070714_100092559 3300005435 Bacteria 2650
12 Ga0070714_100464169 3300005435 Bacteria 1204
13 Ga0070714_100565555 3300005435 Unclassified 1090
14 Ga0070713_100019756 3300005436 Bacteria 5154
15 Ga0070700_100280984 3300005441 Bacteria 1207
16 Ga0068854_100403455 3300005578 Unclassified 1132
17 Ga0068852_100330087 3300005616 Unclassified 1484
18 Ga0068852_100590597 3300005616 Bacteria 1114
19 Ga0068861_100113067 3300005719 Bacteria 2178
20 Ga0081538_10005249 3300005981 Bacteria 11704
21 Ga0081538_10087450 3300005981 Bacteria 1627
22 Ga0081539_10003864 3300005985 Bacteria 17540
23 Ga0070717_10029673 3300006028 Bacteria 4390
24 Ga0075428_100156672 3300006844 Bacteria 2474
25 Ga0075428_100446856 3300006844 Bacteria 1385
26 Ga0075429_100306298 3300006880 Bacteria 1391
27 Ga0111539_10072942 3300009094 Bacteria 4048
28 Ga0105243_10164727 3300009148 Bacteria 1915
29 Ga0105243_10201640 3300009148 Bacteria 1745
30 Ga0105243_10376376 3300009148 Unclassified 1312
31 Ga0105238_10631234 3300009551 Bacteria 1080
32 Ga0105249_10198449 3300009553 Bacteria 1962
33 Ga0163162_10679501 3300013306 Bacteria 1152
34 Ga0157372_10517371 3300013307 Bacteria 1391
35 Ga0157372_10831690 3300013307 Bacteria 1072
36 Ga0157380_10504172 3300014326 Bacteria 1176
37 Ga0213874_10000545 3300021377 Bacteria 7545
38 Ga0213876_10005199 3300021384 Bacteria 7176
39 Ga0213876_10021278 3300021384 Bacteria 3431
40 Ga0213876_10030704 3300021384 Bacteria 2835
41 Ga0213876_10030720 3300021384 Bacteria 2834
42 Ga0207426_1021825 3300025302 Bacteria 2207
43 Ga0207692_10332686 3300025898 Unclassified 932
44 Ga0207645_10135857 3300025907 Bacteria 1601
45 Ga0207664_10001036 3300025929 Bacteria 18631
46 Ga0207664_10304436 3300025929 Bacteria 1403
47 Ga0207664_10415654 3300025929 Bacteria 1198
48 Ga0207690_10250564 3300025932 Bacteria 1368
49 Ga0207690_10545483 3300025932 Bacteria 942
50 Ga0207706_10107154 3300025933 Bacteria 2459
51 Ga0207709_10306112 3300025935 Bacteria 1184
52 Ga0207691_10215157 3300025940 Bacteria 1668
53 Ga0207691_10340643 3300025940 Bacteria 1284
54 Ga0207668_10464030 3300025972 Bacteria 1083
55 Ga0207640_10630062 3300025981 Bacteria 911
56 Ga0207639_10187132 3300026041 Bacteria 1766
57 Ga0207708_10016248 3300026075 Bacteria 5593
58 Ga0207675_100101048 3300026118 Bacteria 2717
59 Ga0207675_100516623 3300026118 Bacteria 1190
60 Ga0268266_10482616 3300028379 Bacteria 1182
61 Ga0307413_10238462 3300031824 Bacteria 1341
62 Ga0307406_10270795 3300031901 Bacteria 1290
63 Ga0307407_10153818 3300031903 Bacteria 1498
64 Ga0307416_100403030 3300032002 Bacteria 1406
65 Ga0307415_100133639 3300032126 Bacteria 1883
66 Ga0307415_100640948 3300032126 Unclassified 951
67 Ga0395900_0014558 3300037418 Bacteria 8026
68 Ga0395898_0010591 3300037466 Bacteria 9628
69 Ga0436364_0820732 3300037853 Bacteria 3278
70 Ga0436365_0265252 3300039437 Bacteria 11939
71 Ga0436365_0426333 3300039437 Bacteria 1325
72 Ga0436365_0765215 3300039437 Bacteria 14228
73 Ga0436365_0934847 3300039437 Bacteria 10390
74 Ga0436365_1274803 3300039437 Bacteria 8483
75 Ga0436365_1623746 3300039437 Bacteria 4860
76 Ga0436363_0983181 3300039450 Bacteria 38641
77 Ga0436362_0317960 3300039453 Bacteria 1211
78 Ga0451791_1699807 3300041451 Bacteria 1759
79 Ga0451853_3348067 3300041512 Bacteria 1855
80 Ga0466969_0020844 3300044656 Bacteria 3391
81 Ga0466969_0057522 3300044656 Bacteria 1895
82 Ga0466965_0079263 3300044683 Bacteria 1659
83 Ga0466966_0044445 3300044684 Bacteria 2844
84 Ga0466966_0050838 3300044684 Bacteria 2636
85 Ga0466966_0269563 3300044684 Bacteria 1024
86 Ga0466966_0354201 3300044684 Unclassified 882
87 Ga0466961_0038164 3300044693 Bacteria 3081
88 Ga0466961_0168827 3300044693 Bacteria 1361
89 Ga0466963_0012255 3300044694 Bacteria 5243
90 Ga0466963_0014092 3300044694 Bacteria 4926
91 Ga0466963_0014264 3300044694 Bacteria 4896
92 Ga0466963_0132781 3300044694 Bacteria 1721
93 Ga0466963_0156781 3300044694 Bacteria 1583
94 Ga0466963_0165330 3300044694 Bacteria 1541
95 Ga0466963_0350278 3300044694 Bacteria 1040
96 Ga0466963_0463474 3300044694 Bacteria 894
97 Ga0466971_0112739 3300044719 Bacteria 1256
98 Ga0466968_0085057 3300044735 Bacteria 1395
99 Ga0466970_0125749 3300044765 Unclassified 1406
100 Ga0466957_0240133 3300044842 Bacteria 1202
101 Ga0466957_0407600 3300044842 Bacteria 931
102 Ga0466960_0152167 3300044901 Bacteria 1237
103 Ga0466959_0004705 3300045049 Bacteria 9191
104 Ga0466959_0045026 3300045049 Bacteria 3250
105 Ga0466959_0072417 3300045049 Bacteria 2494
106 Ga0466959_0124296 3300045049 Bacteria 1832
107 Ga0466959_0181047 3300045049 Unclassified 1474
108 Ga0466958_0004495 3300045836 Bacteria 7365
109 Ga0466958_0025729 3300045836 Bacteria 3473
110 Ga0466958_0026261 3300045836 Bacteria 3441
111 Ga0466958_0047151 3300045836 Bacteria 2602
112 Ga0466958_0151378 3300045836 Bacteria 1463
113 Ga0466958_0186771 3300045836 Bacteria 1316
114 Ga0466958_0294651 3300045836 Bacteria 1041
115 Ga0466967_0008112 3300045976 Bacteria 7661
116 Ga0466967_0032856 3300045976 Bacteria 4387
117 Ga0466967_0055528 3300045976 Bacteria 3488
118 Ga0466967_0176872 3300045976 Bacteria 2010
119 Ga0466967_0239750 3300045976 Bacteria 1729
120 Ga0466967_0260961 3300045976 Bacteria 1657
121 Ga0466967_0442087 3300045976 Bacteria 1270
122 Ga0466967_0657080 3300045976 Bacteria 1037
123 Ga0466967_0880506 3300045976 Bacteria 890
124 Ga0496109_0342256 3300048912 Bacteria 1412
125 Ga0496112_0141522 3300048915 Bacteria 2375
126 Ga0496121_0264296 3300048924 Bacteria 1186
127 Ga0501031_0069649 3300049568 Bacteria 2291
128 Ga0501031_0267137 3300049568 Bacteria 1111
129 Ga0501036_0267649 3300049572 Bacteria 1431
130 Ga0501036_0293925 3300049572 Bacteria 1359
131 Ga0501037_0090391 3300049573 Bacteria 2215
132 Ga0501037_0302623 3300049573 Bacteria 1110
133 Ga0501038_0224376 3300049574 Bacteria 1498
134 Ga0501039_0040799 3300049575 Bacteria 3582
135 Ga0501039_0244673 3300049575 Bacteria 1410
136 Ga0501039_0329866 3300049575 Bacteria 1199
137 Ga0501040_0084338 3300049576 Bacteria 2204
138 Ga0501040_0116513 3300049576 Bacteria 1872
139 Ga0501041_0082035 3300049577 Bacteria 1986
140 Ga0501041_0194316 3300049577 Bacteria 1271
141 Ga0501048_0076784 3300049582 Bacteria 2357
142 Ga0501068_0316720 3300049584 Bacteria 1000
143 Ga0501071_0005049 3300049587 Bacteria 8443
144 Ga0501071_0048727 3300049587 Bacteria 3048
145 Ga0501071_0142197 3300049587 Bacteria 1787
146 Ga0501072_0157286 3300049588 Bacteria 1812
147 Ga0501074_0048919 3300049590 Bacteria 3054
148 Ga0501075_0136152 3300049591 Bacteria 1871
149 Ga0501075_0312980 3300049591 Bacteria 1196
150 Ga0501076_0048365 3300049592 Bacteria 3362
151 Ga0501076_0153384 3300049592 Bacteria 1874
152 Ga0501076_0327653 3300049592 Bacteria 1256
153 Ga0501077_0209555 3300049593 Bacteria 1238
154 Ga0501079_0185106 3300049741 Bacteria 1626
155 Ga0501079_0285130 3300049741 Bacteria 1291
156 Ga0501080_0389442 3300049742 Bacteria 1255
157 Ga0501081_0235508 3300049743 Bacteria 1334
158 Ga0501035_0633920 3300049822 Bacteria 868
159 Ga0501044_0362696 3300049823 Bacteria 1367
160 Ga0501045_0009792 3300049824 Bacteria 6703
161 Ga0501045_0097968 3300049824 Bacteria 2169
162 Ga0501045_0171221 3300049824 Bacteria 1617
163 nmdc:mga08y16_77481_c1 3300050511 Bacteria 3466
164 Ga0495595_0095187 3300053084 Bacteria 1433
165 Ga0501084_0080335 3300054114 Bacteria 2734
166 Ga0501084_0083494 3300054114 Bacteria 2681
167 Ga0501082_0027743 3300060353 Bacteria 4875
168 Ga0466962_0016805 3300061719 Bacteria 3527
169 Ga0466962_0020807 3300061719 Bacteria 3153
170 Ga0466962_0133605 3300061719 Bacteria 1200
171 Ga0466962_0158755 3300061719 Bacteria 1099
172 Ga0530510_0117962 3300061734 Bacteria 1947
173 Ga0530510_0163707 3300061734 Bacteria 1646
174 Ga0466963_0086583
175 Ga0070692_10186070
176 Ga0070692_10199447
177 Ga0070692_10304004
178 Ga0070668_100392946
179 Ga0070668_100425036
180 Ga0070669_100322939
181 Ga0070674_100423402
182 Ga0070659_100067450
183 Ga0070714_100010285
184 Ga0070714_100092559
185 Ga0070714_100464169
186 Ga0070714_100565555
187 Ga0070713_100019756
188 Ga0070700_100280984
189 Ga0068854_100403455
190 Ga0068852_100330087
191 Ga0068852_100590597
192 Ga0068861_100113067
193 Ga0081538_10005249
194 Ga0081538_10087450
195 Ga0081539_10003864
196 Ga0070717_10029673
197 Ga0075428_100156672
198 Ga0075428_100446856
199 Ga0075429_100306298
200 Ga0111539_10072942
201 Ga0105243_10164727
202 Ga0105243_10201640
203 Ga0105243_10376376
204 Ga0105238_10631234
205 Ga0105249_10198449
206 Ga0163162_10679501
207 Ga0157372_10517371
208 Ga0157372_10831690
209 Ga0157380_10504172
210 Ga0213874_10000545
211 Ga0213876_10005199
212 Ga0213876_10021278
213 Ga0213876_10030704
214 Ga0213876_10030720
215 Ga0207426_1021825
216 Ga0207692_10332686
217 Ga0207645_10135857
218 Ga0207664_10001036
219 Ga0207664_10304436
220 Ga0207664_10415654
221 Ga0207690_10250564
222 Ga0207690_10545483
223 Ga0207706_10107154
224 Ga0207709_10306112
225 Ga0207691_10215157
226 Ga0207691_10340643
227 Ga0207668_10464030
228 Ga0207640_10630062
229 Ga0207639_10187132
230 Ga0207708_10016248
231 Ga0207675_100101048
232 Ga0207675_100516623
233 Ga0268266_10482616
234 Ga0307413_10238462
235 Ga0307406_10270795
236 Ga0307407_10153818
237 Ga0307416_100403030
238 Ga0307415_100133639
239 Ga0307415_100640948
240 Ga0395900_0014558
241 Ga0395898_0010591
242 Ga0436364_0820732
243 Ga0436365_0265252
244 Ga0436365_0426333
245 Ga0436365_0765215
246 Ga0436365_0934847
247 Ga0436365_1274803
248 Ga0436365_1623746
249 Ga0436363_0983181
250 Ga0436362_0317960
251 Ga0451791_1699807
252 Ga0451853_3348067
253 Ga0466969_0020844
254 Ga0466969_0057522
255 Ga0466965_0079263
256 Ga0466966_0044445
257 Ga0466966_0050838
258 Ga0466966_0269563
259 Ga0466966_0354201
260 Ga0466961_0038164
261 Ga0466961_0168827
262 Ga0466963_0012255
263 Ga0466963_0014092
264 Ga0466963_0014264
265 Ga0466963_0132781
266 Ga0466963_0156781
267 Ga0466963_0165330
268 Ga0466963_0350278
269 Ga0466963_0463474
270 Ga0466971_0112739
271 Ga0466968_0085057
272 Ga0466970_0125749
273 Ga0466957_0240133
274 Ga0466957_0407600
275 Ga0466960_0152167
276 Ga0466959_0004705
277 Ga0466959_0045026
278 Ga0466959_0072417
279 Ga0466959_0124296
280 Ga0466959_0181047
281 Ga0466958_0004495
282 Ga0466958_0025729
283 Ga0466958_0026261
284 Ga0466958_0047151
285 Ga0466958_0151378
286 Ga0466958_0186771
287 Ga0466958_0294651
288 Ga0466967_0008112
289 Ga0466967_0032856
290 Ga0466967_0055528
291 Ga0466967_0176872
292 Ga0466967_0239750
293 Ga0466967_0260961
294 Ga0466967_0442087
295 Ga0466967_0657080
296 Ga0466967_0880506
297 Ga0496109_0342256
298 Ga0496112_0141522
299 Ga0496121_0264296
300 Ga0501031_0069649
301 Ga0501031_0267137
302 Ga0501036_0267649
303 Ga0501036_0293925
304 Ga0501037_0090391
305 Ga0501037_0302623
306 Ga0501038_0224376
307 Ga0501039_0040799
308 Ga0501039_0244673
309 Ga0501039_0329866
310 Ga0501040_0084338
311 Ga0501040_0116513
312 Ga0501041_0082035
313 Ga0501041_0194316
314 Ga0501048_0076784
315 Ga0501068_0316720
316 Ga0501071_0005049
317 Ga0501071_0048727
318 Ga0501071_0142197
319 Ga0501072_0157286
320 Ga0501074_0048919
321 Ga0501075_0136152
322 Ga0501075_0312980
323 Ga0501076_0048365
324 Ga0501076_0153384
325 Ga0501076_0327653
326 Ga0501077_0209555
327 Ga0501079_0185106
328 Ga0501079_0285130
329 Ga0501080_0389442
330 Ga0501081_0235508
331 Ga0501035_0633920
332 Ga0501044_0362696
333 Ga0501045_0009792
334 Ga0501045_0097968
335 Ga0501045_0171221
336 nmdc:mga08y16_77481_c1
337 Ga0495595_0095187
338 Ga0501084_0080335
339 Ga0501084_0083494
340 Ga0501082_0027743
341 Ga0466962_0016805
342 Ga0466962_0020807
343 Ga0466962_0133605
344 Ga0466962_0158755
345 Ga0530510_0117962
346 Ga0530510_0163707

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

69

166

0.96

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

51

180

0.93

PF13649

Methyltransf_25

Methyltransferase domain

66

162

0.92

PF08242

Methyltransf_12

Methyltransferase domain

67

164

0.86

PF13847

Methyltransf_31

Methyltransferase domain

60

218

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wwq-assembly1.cif.gz_A crystal structure of human nsun6 0.8702 39 156
5c0o-assembly1.cif.gz_E m1a58 trna methyltransferase mutant - y78a 0.8449 37 218
3e05-assembly1.cif.gz_A crystal structure of precorrin-6y c5,15-methyltransferase from geobacter metallireducens gs-15 0.842 38 219
5c0o-assembly1.cif.gz_H m1a58 trna methyltransferase mutant - y78a 0.8417 37 218
5c0o-assembly1.cif.gz_G m1a58 trna methyltransferase mutant - y78a 0.8383 37 218
ID Description Score Start End Superfamily
af_Q54LU3_44_217_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9357 40 155 3.40.50.150
af_K7LTE4_237_888_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9255 38 111 3.40.50.150
af_B7ZXR6_266_358_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9181 39 114 3.40.50.150
af_Q55DF6_53_245_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9082 38 116 3.40.50.150
af_A0A368UL97_81_217_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8957 38 126 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2Z5JPE9-F1-model_v4 Methyltransferase domain-containing protein 0.9643 40 146 GO:0008168
GO:0009058
AF-A0A832K672-F1-model_v4 Arsenite methyltransferase (EC 2.1.1.137) 0.9601 43 155 GO:0008168
GO:0032259
AF-A0A1Z4T6Q9-F1-model_v4 deleted 0.9584 49 155
AF-A0A6N7YK55-F1-model_v4 Methyltransferase domain-containing protein 0.9566 42 285 GO:0008168
GO:0032259
AF-A0A2E0S3V4-F1-model_v4 SAM-dependent methyltransferase 0.9549 50 149 GO:0008168
GO:0032259

Map