F262140

General Info

Members Datasets Scaffolds Average Seq Length
173 136 346 117

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100000028|Ga0070713_10000002849
Length 131
Sequence MSCPAWLRLGRYAVKRSHAPVLWALFGAGGMLAALIAPMLIFITGIAAPTGLLLPNDTMSFERMTALARNGFAKLALVMIVSLFMFHGGLRMFHSLHHLGFAAGAKAQIVIFAGAVLATALAAWAVLAIGF

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
118 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
119 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
120 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
121 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
122 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
123 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
124 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
129 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
130 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
131 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
135 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
136 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.73
Rhizosphere 98.27
Stem 0
Stem Tuber 0
Unclassified 15.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100000028 3300005436 Bacteria 93227
2 Ga0070683_100113100 3300005329 Bacteria 2562
3 Ga0070670_101138811 3300005331 Bacteria 712
4 Ga0070670_101332132 3300005331 Bacteria 658
5 Ga0070680_100452298 3300005336 Bacteria 1097
6 Ga0068868_100021374 3300005338 Bacteria 4873
7 Ga0068868_100344704 3300005338 Unclassified 1275
8 Ga0070660_100179040 3300005339 Bacteria 1715
9 Ga0070687_101363467 3300005343 Bacteria 529
10 Ga0070661_100842022 3300005344 Bacteria 754
11 Ga0070669_101183046 3300005353 Bacteria 660
12 Ga0070671_100018499 3300005355 Bacteria 5660
13 Ga0070673_101600140 3300005364 Unclassified 615
14 Ga0070659_100132612 3300005366 Bacteria 2024
15 Ga0070667_100024964 3300005367 Bacteria 4965
16 Ga0070667_100793274 3300005367 Bacteria 879
17 Ga0070703_10185916 3300005406 Bacteria 806
18 Ga0070714_100167480 3300005435 Bacteria 1992
19 Ga0070713_100071290 3300005436 Bacteria 2935
20 Ga0070710_11222185 3300005437 Bacteria 556
21 Ga0070710_11288642 3300005437 Unclassified 543
22 Ga0070701_10799901 3300005438 Bacteria 643
23 Ga0070701_11362750 3300005438 Unclassified 509
24 Ga0070711_100282518 3300005439 Unclassified 1314
25 Ga0070711_101099288 3300005439 Bacteria 685
26 Ga0070705_100141604 3300005440 Bacteria 1583
27 Ga0070694_100034088 3300005444 Bacteria 3355
28 Ga0070694_101413338 3300005444 Bacteria 587
29 Ga0070708_101666950 3300005445 Unclassified 593
30 Ga0070678_100380698 3300005456 Bacteria 1221
31 Ga0068867_102325592 3300005459 Bacteria 509
32 Ga0070706_100024622 3300005467 Bacteria 5542
33 Ga0070706_101516827 3300005467 Bacteria 612
34 Ga0070698_100323525 3300005471 Bacteria 1473
35 Ga0070698_102030407 3300005471 Bacteria 528
36 Ga0070679_100389805 3300005530 Bacteria 1339
37 Ga0070684_101049256 3300005535 Unclassified 765
38 Ga0068853_100159648 3300005539 Bacteria 2034
39 Ga0068853_100327390 3300005539 Bacteria 1421
40 Ga0070686_100725125 3300005544 Bacteria 795
41 Ga0070696_100426638 3300005546 Bacteria 1042
42 Ga0070693_101091464 3300005547 Bacteria 608
43 Ga0070704_100048540 3300005549 Bacteria 2972
44 Ga0070704_100240981 3300005549 Bacteria 1480
45 Ga0070704_101367358 3300005549 Unclassified 649
46 Ga0070704_101991878 3300005549 Unclassified 539
47 Ga0068855_100041563 3300005563 Bacteria 5449
48 Ga0068854_101777008 3300005578 Unclassified 565
49 Ga0068852_100008051 3300005616 Bacteria 7731
50 Ga0068852_100031310 3300005616 Bacteria 4388
51 Ga0068859_100158054 3300005617 Bacteria 2345
52 Ga0068859_102385944 3300005617 Unclassified 583
53 Ga0068864_100752829 3300005618 Bacteria 955
54 Ga0068870_10574585 3300005840 Unclassified 762
55 Ga0068863_101427344 3300005841 Unclassified 700
56 Ga0068858_100317859 3300005842 Bacteria 1487
57 Ga0097621_102083174 3300006237 Bacteria 542
58 Ga0068871_101755469 3300006358 Bacteria 589
59 Ga0075434_100085641 3300006871 Bacteria 3151
60 Ga0068865_100438615 3300006881 Bacteria 1077
61 Ga0075436_100005014 3300006914 Bacteria 9098
62 Ga0097620_100158068 3300006931 Bacteria 2345
63 Ga0097620_102386736 3300006931 Unclassified 583
64 Ga0105240_10107001 3300009093 Bacteria 3391
65 Ga0105240_10131108 3300009093 Bacteria 3007
66 Ga0105247_11179671 3300009101 Unclassified 608
67 Ga0114129_11245717 3300009147 Bacteria 924
68 Ga0105241_11204141 3300009174 Bacteria 717
69 Ga0105242_10038116 3300009176 Bacteria 3863
70 Ga0105248_10137543 3300009177 Bacteria 2756
71 Ga0105238_10021868 3300009551 Bacteria 6515
72 Ga0105249_10898447 3300009553 Unclassified 953
73 Ga0105239_11431305 3300010375 Bacteria 798
74 Ga0157369_10145006 3300013105 Bacteria 2511
75 Ga0157369_12594133 3300013105 Bacteria 512
76 Ga0157378_10005529 3300013297 Bacteria 11066
77 Ga0163162_10399101 3300013306 Bacteria 1508
78 Ga0163162_11875724 3300013306 Bacteria 686
79 Ga0157372_10005831 3300013307 Bacteria 13119
80 Ga0163163_11169992 3300014325 Unclassified 832
81 Ga0157379_10008729 3300014968 Bacteria 8832
82 Ga0206353_10866746 3300020082 Bacteria 794
83 Ga0213873_10102873 3300021358 Bacteria 823
84 Ga0213872_10216798 3300021361 Bacteria 816
85 Ga0213871_10030376 3300021441 Bacteria 1406
86 Ga0207680_10112406 3300025903 Bacteria 1769
87 Ga0207699_10207589 3300025906 Bacteria 1331
88 Ga0207684_10177431 3300025910 Bacteria 1837
89 Ga0207654_10577600 3300025911 Bacteria 800
90 Ga0207695_10062630 3300025913 Bacteria 3839
91 Ga0207695_10309841 3300025913 Bacteria 1469
92 Ga0207663_10246055 3300025916 Bacteria 1314
93 Ga0207663_10263677 3300025916 Bacteria 1273
94 Ga0207663_10266180 3300025916 Bacteria 1268
95 Ga0207662_10087861 3300025918 Bacteria 1908
96 Ga0207657_10156407 3300025919 Bacteria 1854
97 Ga0207652_10561140 3300025921 Bacteria 1026
98 Ga0207681_10704055 3300025923 Bacteria 840
99 Ga0207694_10199536 3300025924 Unclassified 1627
100 Ga0207694_11020240 3300025924 Bacteria 700
101 Ga0207650_10454152 3300025925 Bacteria 1067
102 Ga0207700_11226109 3300025928 Unclassified 669
103 Ga0207664_10048891 3300025929 Bacteria 3328
104 Ga0207644_10026663 3300025931 Bacteria 3985
105 Ga0207690_10095153 3300025932 Bacteria 2115
106 Ga0207704_11060140 3300025938 Bacteria 688
107 Ga0207711_10118609 3300025941 Bacteria 2361
108 Ga0207667_10066427 3300025949 Bacteria 3759
109 Ga0207712_10748423 3300025961 Bacteria 856
110 Ga0207712_11854373 3300025961 Unclassified 540
111 Ga0207668_10825564 3300025972 Bacteria 822
112 Ga0207658_10035747 3300025986 Bacteria 3559
113 Ga0207658_10187023 3300025986 Bacteria 1719
114 Ga0207658_10591457 3300025986 Bacteria 996
115 Ga0207677_10024189 3300026023 Bacteria 3769
116 Ga0207703_10096210 3300026035 Unclassified 2499
117 Ga0207639_10058430 3300026041 Bacteria 2967
118 Ga0207639_10295379 3300026041 Bacteria 1430
119 Ga0207648_10893594 3300026089 Bacteria 830
120 Ga0207676_10495169 3300026095 Bacteria 1160
121 Ga0207683_10903966 3300026121 Bacteria 820
122 Ga0207698_10025742 3300026142 Bacteria 4151
123 Ga0207698_10077707 3300026142 Bacteria 2662
124 Ga0307408_100012594 3300031548 Bacteria 5606
125 Ga0316578_10664151 3300031728 Bacteria 608
126 Ga0307405_10048236 3300031731 Bacteria 2626
127 Ga0307405_10383413 3300031731 Bacteria 1095
128 Ga0307410_10895611 3300031852 Bacteria 760
129 Ga0307406_10365905 3300031901 Bacteria 1132
130 Ga0307406_10474417 3300031901 Bacteria 1009
131 Ga0307412_10134077 3300031911 Bacteria 1804
132 Ga0307416_100115844 3300032002 Bacteria 2374
133 Ga0307416_102398926 3300032002 Unclassified 627
134 Ga0307411_10520713 3300032005 Bacteria 1009
135 Ga0307415_100441569 3300032126 Bacteria 1122
136 Ga0373956_0338146 3300035119 Bacteria 718
137 Ga0373956_0369118 3300035119 Bacteria 684
138 Ga0373955_0066267 3300035172 Bacteria 2007
139 Ga0373942_0359188 3300035207 Bacteria 516
140 Ga0373931_0015854 3300035691 Bacteria 3700
141 Ga0373933_0385771 3300035724 Bacteria 913
142 Ga0373937_0182824 3300036401 Bacteria 1969
143 Ga0395905_0004424 3300037471 Bacteria 14604
144 Ga0436360_0085165 3300039438 Bacteria 8407
145 Ga0436361_0161521 3300039447 Unclassified 3205
146 Ga0436362_0262817 3300039453 Bacteria 2660
147 Ga0451577_0002648 3300042876 Bacteria 20969
148 Ga0451577_0060818 3300042876 Bacteria 3368
149 Ga0451577_0422958 3300042876 Bacteria 1210
150 Ga0453683_0132944 3300044673 Unclassified 1569
151 Ga0451576_0271215 3300045051 Bacteria 1774
152 Ga0451576_0280640 3300045051 Bacteria 1742
153 Ga0451576_0614454 3300045051 Bacteria 1142
154 Ga0495641_0511572 3300046461 Unclassified 548
155 Ga0495598_0385149 3300046537 Bacteria 545
156 Ga0495621_0015597 3300046539 Bacteria 2425
157 Ga0495659_0141125 3300046664 Bacteria 962
158 Ga0495657_0065023 3300046675 Bacteria 2400
159 Ga0495647_0182598 3300046681 Unclassified 913
160 Ga0495669_0006417 3300046684 Bacteria 4910
161 Ga0495670_0286607 3300046691 Bacteria 881
162 Ga0496101_1556377 3300048904 Unclassified 514
163 Ga0496114_0433069 3300048917 Bacteria 1165
164 Ga0496115_1201301 3300048918 Bacteria 570
165 Ga0501071_1092527 3300049587 Bacteria 616
166 Ga0501072_0328015 3300049588 Bacteria 1216
167 Ga0501076_0405179 3300049592 Bacteria 1122
168 Ga0501079_0213254 3300049741 Bacteria 1508
169 Ga0501045_0087311 3300049824 Bacteria 2303
170 nmdc:mga0n895_95647_c1 3300050512 Bacteria 2975
171 nmdc:mga0rr50_329047_c1 3300050513 Bacteria 1282
172 nmdc:mga08x19_27620_c1 3300050514 Bacteria 3550
173 Ga0495601_0163424 3300053077 Bacteria 1455
174 Ga0070713_100000028
175 Ga0070683_100113100
176 Ga0070670_101138811
177 Ga0070670_101332132
178 Ga0070680_100452298
179 Ga0068868_100021374
180 Ga0068868_100344704
181 Ga0070660_100179040
182 Ga0070687_101363467
183 Ga0070661_100842022
184 Ga0070669_101183046
185 Ga0070671_100018499
186 Ga0070673_101600140
187 Ga0070659_100132612
188 Ga0070667_100024964
189 Ga0070667_100793274
190 Ga0070703_10185916
191 Ga0070714_100167480
192 Ga0070713_100071290
193 Ga0070710_11222185
194 Ga0070710_11288642
195 Ga0070701_10799901
196 Ga0070701_11362750
197 Ga0070711_100282518
198 Ga0070711_101099288
199 Ga0070705_100141604
200 Ga0070694_100034088
201 Ga0070694_101413338
202 Ga0070708_101666950
203 Ga0070678_100380698
204 Ga0068867_102325592
205 Ga0070706_100024622
206 Ga0070706_101516827
207 Ga0070698_100323525
208 Ga0070698_102030407
209 Ga0070679_100389805
210 Ga0070684_101049256
211 Ga0068853_100159648
212 Ga0068853_100327390
213 Ga0070686_100725125
214 Ga0070696_100426638
215 Ga0070693_101091464
216 Ga0070704_100048540
217 Ga0070704_100240981
218 Ga0070704_101367358
219 Ga0070704_101991878
220 Ga0068855_100041563
221 Ga0068854_101777008
222 Ga0068852_100008051
223 Ga0068852_100031310
224 Ga0068859_100158054
225 Ga0068859_102385944
226 Ga0068864_100752829
227 Ga0068870_10574585
228 Ga0068863_101427344
229 Ga0068858_100317859
230 Ga0097621_102083174
231 Ga0068871_101755469
232 Ga0075434_100085641
233 Ga0068865_100438615
234 Ga0075436_100005014
235 Ga0097620_100158068
236 Ga0097620_102386736
237 Ga0105240_10107001
238 Ga0105240_10131108
239 Ga0105247_11179671
240 Ga0114129_11245717
241 Ga0105241_11204141
242 Ga0105242_10038116
243 Ga0105248_10137543
244 Ga0105238_10021868
245 Ga0105249_10898447
246 Ga0105239_11431305
247 Ga0157369_10145006
248 Ga0157369_12594133
249 Ga0157378_10005529
250 Ga0163162_10399101
251 Ga0163162_11875724
252 Ga0157372_10005831
253 Ga0163163_11169992
254 Ga0157379_10008729
255 Ga0206353_10866746
256 Ga0213873_10102873
257 Ga0213872_10216798
258 Ga0213871_10030376
259 Ga0207680_10112406
260 Ga0207699_10207589
261 Ga0207684_10177431
262 Ga0207654_10577600
263 Ga0207695_10062630
264 Ga0207695_10309841
265 Ga0207663_10246055
266 Ga0207663_10263677
267 Ga0207663_10266180
268 Ga0207662_10087861
269 Ga0207657_10156407
270 Ga0207652_10561140
271 Ga0207681_10704055
272 Ga0207694_10199536
273 Ga0207694_11020240
274 Ga0207650_10454152
275 Ga0207700_11226109
276 Ga0207664_10048891
277 Ga0207644_10026663
278 Ga0207690_10095153
279 Ga0207704_11060140
280 Ga0207711_10118609
281 Ga0207667_10066427
282 Ga0207712_10748423
283 Ga0207712_11854373
284 Ga0207668_10825564
285 Ga0207658_10035747
286 Ga0207658_10187023
287 Ga0207658_10591457
288 Ga0207677_10024189
289 Ga0207703_10096210
290 Ga0207639_10058430
291 Ga0207639_10295379
292 Ga0207648_10893594
293 Ga0207676_10495169
294 Ga0207683_10903966
295 Ga0207698_10025742
296 Ga0207698_10077707
297 Ga0307408_100012594
298 Ga0316578_10664151
299 Ga0307405_10048236
300 Ga0307405_10383413
301 Ga0307410_10895611
302 Ga0307406_10365905
303 Ga0307406_10474417
304 Ga0307412_10134077
305 Ga0307416_100115844
306 Ga0307416_102398926
307 Ga0307411_10520713
308 Ga0307415_100441569
309 Ga0373956_0338146
310 Ga0373956_0369118
311 Ga0373955_0066267
312 Ga0373942_0359188
313 Ga0373931_0015854
314 Ga0373933_0385771
315 Ga0373937_0182824
316 Ga0395905_0004424
317 Ga0436360_0085165
318 Ga0436361_0161521
319 Ga0436362_0262817
320 Ga0451577_0002648
321 Ga0451577_0060818
322 Ga0451577_0422958
323 Ga0453683_0132944
324 Ga0451576_0271215
325 Ga0451576_0280640
326 Ga0451576_0614454
327 Ga0495641_0511572
328 Ga0495598_0385149
329 Ga0495621_0015597
330 Ga0495659_0141125
331 Ga0495657_0065023
332 Ga0495647_0182598
333 Ga0495669_0006417
334 Ga0495670_0286607
335 Ga0496101_1556377
336 Ga0496114_0433069
337 Ga0496115_1201301
338 Ga0501071_1092527
339 Ga0501072_0328015
340 Ga0501076_0405179
341 Ga0501079_0213254
342 Ga0501045_0087311
343 nmdc:mga0n895_95647_c1
344 nmdc:mga0rr50_329047_c1
345 nmdc:mga08x19_27620_c1
346 Ga0495601_0163424

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02313

Fumarate_red_D

Fumarate reductase subunit D

13

127

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b76-assembly2.cif.gz_P e. coli quinol fumarate reductase frda e49q mutation 0.778 3 116
3cir-assembly1.cif.gz_D e. coli quinol fumarate reductase frda t234a mutation 0.7747 1 116
2acz-assembly1.cif.gz_C-2 complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site 0.6125 8 117
2acz-assembly1.cif.gz_C-3 complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site 0.6125 8 117
6wu6-assembly1.cif.gz_C succinate-coenzyme q reductase 0.6105 1 119
ID Description Score Start End Superfamily
af_P0A8Q3_1_119_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.7781 1 116 1.20.1300.10
3p4pP00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.778 1 116 1.20.1300.10
1fumD00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.7747 1 116 1.20.1300.10
2b76D00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.7746 1 116 1.20.1300.10
1kf6D00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.7725 1 111 1.20.1300.10
ID Description Score Start End GO Terms
AF-A0A090TBD8-F1-model_v4 Fumarate reductase subunit D 0.9282 49 116 GO:0005886
GO:0006106
AF-A0A090TBD8-F1-model_v4 Fumarate reductase subunit D 0.8798 49 116 GO:0005886
GO:0006106
AF-A0A7X3UXK4-F1-model_v4 Fumarate reductase subunit D 0.8302 4 116 GO:0005886
GO:0006106
AF-A0A0K1J0Y2-F1-model_v4 deleted 0.8198 20 119
AF-A0A7Y4FKX1-F1-model_v4 Fumarate reductase subunit FrdD 0.8194 15 116 GO:0005886
GO:0006106

Map