F261317

General Info

Members Datasets Scaffolds Average Seq Length
172 139 124 133

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0006661|Ga0495606_0006661_4551_4964
Length 137
Sequence MKELNMTTRDVVFAPGRQALNEMHRYSPAVRSNGLLFVSGQVGSREDGSPEPELKTQVRKAFQNLNAVLAAAGCTFDDVVDVTIFILNPDQVFEMLWNEVVPEYWGKAPYPNATVVGVTWLAGFQFEIKVVARLPKD

Samples

Sample ID Description Type Environment
1 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
2 2511231011 Pseudomonas sp. GM30 Isolate Nodule
3 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
4 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
5 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
6 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
7 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
8 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
9 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
10 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
11 2643221557 Ensifer sp. Root558 Isolate Unclassified
12 2643221610 Ensifer sp. Root74 Isolate Unclassified
13 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
14 2643221668 Ensifer sp. Root423 Isolate Unclassified
15 2643221675 Ensifer sp. Root1298 Isolate Unclassified
16 2643221680 Ensifer sp. Root1312 Isolate Unclassified
17 2643221726 Ensifer sp. Root954 Isolate Unclassified
18 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
19 2851182111 Bosea sp. Tri-44 Isolate Nodule
20 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
21 2885198086 Variovorax sp. 679 Isolate Unclassified
22 2885211737 Variovorax sp. 553 Isolate Unclassified
23 2899924645 Variovorax sp. 369 Isolate Unclassified
24 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
25 2904456579 Variovorax sp. 2002 Isolate Unclassified
26 2919404418 Luteibacter sp. 3190 Isolate Unclassified
27 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
28 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
29 2928037797 Variovorax sp. 1126 Isolate Unclassified
30 2928044640 Variovorax sp. 1128 Isolate Unclassified
31 2928051484 Variovorax sp. 1133 Isolate Unclassified
32 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
33 2928070936 Variovorax gossypii 1167 Isolate Unclassified
34 2929520902 Variovorax beijingensis 502 Isolate Unclassified
35 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
36 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
37 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
38 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
39 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
40 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
41 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
42 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
43 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
44 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
45 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
46 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
47 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
48 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
49 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
50 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
51 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
52 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
68 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
69 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
95 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
96 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
97 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
98 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
99 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
100 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
101 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
102 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
103 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
104 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
105 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
106 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
107 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
108 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
109 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
110 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
113 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
114 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
115 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
118 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
119 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
120 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
121 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
122 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
123 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
124 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
125 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
126 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
127 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
128 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
129 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
130 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
131 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
132 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
133 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
134 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
135 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
136 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
137 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
138 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
139 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 71.51
Metatranscriptomes 0.58
Isolates 27.91

Biome Distribution

Category Percentage (%)
Aerial Root 0.58
Bulb 0
Endosphere 30.81
Nodule 4.65
Rhizoplane 3.49
Rhizosphere 38.95
Stem 0
Stem Tuber 0
Unclassified 21.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006562J51391_1119062 3300003578 Bacteria 1860
2 Ga0055524_1067694 3300003775 Bacteria 703
3 Ga0055540_1088520 3300003792 Bacteria 586
4 Ga0058692_1001911 3300003856 Bacteria 7278
5 Ga0065714_10007550 3300005288 Bacteria 2984
6 Ga0065704_10137622 3300005289 Bacteria 1553
7 Ga0065704_10276340 3300005289 Bacteria 932
8 Ga0070670_101382724 3300005331 Bacteria 645
9 Ga0075365_10447309 3300006038 Bacteria 912
10 Ga0075365_11287333 3300006038 Bacteria 514
11 Ga0075368_10039159 3300006042 Bacteria 1857
12 Ga0075363_100003696 3300006048 Bacteria 6579
13 Ga0075363_100006211 3300006048 Bacteria 5402
14 Ga0075363_100060878 3300006048 Bacteria 2033
15 Ga0075364_10000078 3300006051 Bacteria 38360
16 Ga0075364_10083255 3300006051 Bacteria 2117
17 Ga0075364_10480607 3300006051 Bacteria 849
18 Ga0075432_10020422 3300006058 Bacteria 2265
19 Ga0075367_10030167 3300006178 Bacteria 3107
20 Ga0075369_10335557 3300006186 Bacteria 708
21 Ga0075370_10793020 3300006353 Bacteria 577
22 Ga0075430_100320697 3300006846 Bacteria 1281
23 Ga0068865_100221172 3300006881 Bacteria 1480
24 Ga0068865_100422655 3300006881 Bacteria 1096
25 Ga0105251_10014664 3300009011 Bacteria 4321
26 Ga0105238_10224521 3300009551 Bacteria 1855
27 Ga0105246_10146485 3300011119 Bacteria 1782
28 Ga0157370_10120083 3300013104 Bacteria 2454
29 Ga0157370_10313143 3300013104 Bacteria 1448
30 Ga0157370_10334997 3300013104 Bacteria 1395
31 Ga0157370_11284214 3300013104 Bacteria 660
32 Ga0182006_1007247 3300015261 Bacteria 5089
33 Ga0182005_1011534 3300015265 Bacteria 2517
34 Ga0209565_1024208 3300025263 Bacteria 1238
35 Ga0209673_1001396 3300025273 Bacteria 23530
36 Ga0209025_1039648 3300025294 Bacteria 2051
37 Ga0209564_1000013 3300025295 Bacteria 775755
38 Ga0209050_1017398 3300025298 Bacteria 2870
39 Ga0209050_1045391 3300025298 Bacteria 1165
40 Ga0209050_1050535 3300025298 Bacteria 1056
41 Ga0209256_1000042 3300025299 Bacteria 341821
42 Ga0209256_1000745 3300025299 Bacteria 42627
43 Ga0209256_1003652 3300025299 Bacteria 10524
44 Ga0207426_1051395 3300025302 Bacteria 1224
45 Ga0209051_1027581 3300025303 Bacteria 2260
46 Ga0209051_1133122 3300025303 Bacteria 611
47 Ga0209257_1000418 3300025304 Bacteria 82230
48 Ga0209257_1051749 3300025304 Bacteria 1156
49 Ga0209257_1069471 3300025304 Bacteria 933
50 Ga0207681_10749238 3300025923 Bacteria 814
51 Ga0207709_10421894 3300025935 Bacteria 1025
52 Ga0207704_10586207 3300025938 Bacteria 911
53 Ga0209371_1001105 3300027312 Bacteria 19999
54 Ga0209813_10178767 3300027866 Bacteria 775
55 Ga0307515_10033784 3300028794 Bacteria 8406
56 Ga0307515_10540669 3300028794 Bacteria 775
57 Ga0268256_1000949 3300030500 Bacteria 19813
58 Ga0307408_100000212 3300031548 Bacteria 62138
59 Ga0307408_101169810 3300031548 Bacteria 716
60 Ga0307405_10839096 3300031731 Bacteria 773
61 Ga0307413_10086688 3300031824 Bacteria 2025
62 Ga0307410_10123029 3300031852 Bacteria 1895
63 Ga0307406_10000183 3300031901 Bacteria 37495
64 Ga0307407_11342087 3300031903 Bacteria 562
65 Ga0307412_10049757 3300031911 Bacteria 2762
66 Ga0307409_102505212 3300031995 Bacteria 545
67 Ga0307411_11057499 3300032005 Bacteria 729
68 Ga0439436_0118142 3300041404 Bacteria 741
69 Ga0439461_0139296 3300041410 Bacteria 619
70 Ga0439466_0023044 3300041411 Bacteria 2192
71 Ga0451802_1416109 3300041460 Bacteria 583
72 Ga0439437_046432 3300042000 Bacteria 571
73 Ga0439445_0001714 3300042004 Bacteria 4820
74 Ga0439445_0029703 3300042004 Bacteria 1414
75 Ga0450920_113625 3300042122 Bacteria 566
76 Ga0450921_007334 3300042123 Bacteria 875
77 Ga0450890_015304 3300042127 Bacteria 1009
78 Ga0450894_074356 3300042131 Bacteria 523
79 Ga0450896_009532 3300042133 Bacteria 1353
80 Ga0450898_003127 3300042134 Bacteria 2358
81 Ga0450905_001930 3300042142 Bacteria 2647
82 Ga0450908_001912 3300042184 Bacteria 4073
83 Ga0439434_0007982 3300042435 Bacteria 3101
84 Ga0450918_002326 3300042531 Bacteria 3596
85 Ga0466960_0100540 3300044901 Bacteria 1488
86 Ga0466959_0464610 3300045049 Bacteria 857
87 Ga0495617_042032 3300046452 Bacteria 1528
88 Ga0495606_0006661 3300046507 Bacteria 10595
89 Ga0495610_0002988 3300046512 Bacteria 13628
90 Ga0495625_0000052 3300046660 Bacteria 190656
91 Ga0495625_0001579 3300046660 Bacteria 27104
92 Ga0495625_0011460 3300046660 Bacteria 7230
93 Ga0495625_0029553 3300046660 Bacteria 4096
94 Ga0495672_0001513 3300047320 Bacteria 22778
95 Ga0496116_0009267 3300048919 Bacteria 8420
96 Ga0496116_0139229 3300048919 Bacteria 1368
97 Ga0496119_0126972 3300048922 Bacteria 1394
98 Ga0496121_0000119 3300048924 Bacteria 175072
99 Ga0496121_0558491 3300048924 Bacteria 715
100 Ga0496122_0001186 3300048925 Bacteria 44609
101 Ga0496123_0000698 3300048926 Bacteria 55212
102 Ga0496125_0137071 3300048928 Bacteria 1709
103 Ga0496126_1268397 3300048929 Bacteria 538
104 nmdc:mga03683_16661_c2 3300050489 Bacteria 1783
105 nmdc:mga03683_45936_c2 3300050489 Bacteria 1261
106 nmdc:mga03n38_37005_c1 3300050490 Bacteria 2102
107 nmdc:mga03n38_37987_c1 3300050490 Bacteria 2080
108 nmdc:mga00v17_14257_c1 3300050491 Bacteria 4433
109 nmdc:mga00v17_161_c1 3300050491 Bacteria 38859
110 nmdc:mga00v17_421647_c1 3300050491 Bacteria 867
111 nmdc:mga00v17_63376_c1 3300050491 Bacteria 2276
112 nmdc:mga0yw44_38763_c1 3300050492 Bacteria 2822
113 nmdc:mga0yw44_434661_c1 3300050492 Bacteria 889
114 nmdc:mga0k408_4257_c1 3300050493 Bacteria 7595
115 nmdc:mga06z11_212151_c1 3300050494 Bacteria 1129
116 nmdc:mga06z11_37064_c1 3300050494 Bacteria 2412
117 nmdc:mga04h51_10922_c1 3300050495 Bacteria 2508
118 nmdc:mga04h51_206929_c1 3300050495 Bacteria 773
119 nmdc:mga07m45_163479_c1 3300050496 Bacteria 1293
120 nmdc:mga0sz30_63636_c1 3300050516 Bacteria 1579
121 Ga0500568_0182496 3300053139 Bacteria 771
122 Ga0500604_0022083 3300053151 Bacteria 1803
123 Ga0500622_0161864 3300053156 Bacteria 1049
124 Ga0500645_019015 3300053730 Bacteria 2140

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046452 Ga0495617_042032 Ga0495617_042032_909_1304 126
2 iso_pu_bacteria 2511231011 2511298501 126
3 iso_pu_bacteria 2931380184 2931382854 128
4 iso_pu_bacteria 2961064222 2961064339 128
5 3300003856 Ga0058692_1001911 Ga0058692_10019114 129
6 3300005289 Ga0065704_10137622 Ga0065704_101376222 129
7 3300009011 Ga0105251_10014664 Ga0105251_100146643 129
8 3300009551 Ga0105238_10224521 Ga0105238_102245213 129
9 3300013104 Ga0157370_10120083 Ga0157370_101200832 129
10 3300013104 Ga0157370_10334997 Ga0157370_103349971 129
11 3300015261 Ga0182006_1007247 Ga0182006_10072477 129
12 3300015265 Ga0182005_1011534 Ga0182005_10115344 129
13 3300025298 Ga0209050_1045391 Ga0209050_10453912 129
14 3300025304 Ga0209257_1051749 Ga0209257_10517492 129
15 3300027312 Ga0209371_1001105 Ga0209371_10011058 129
16 3300030500 Ga0268256_1000949 Ga0268256_100094921 129
17 3300048919 Ga0496116_0009267 Ga0496116_0009267_1093_1482 129
18 3300048919 Ga0496116_0139229 Ga0496116_0139229_437_826 129
19 3300048922 Ga0496119_0126972 Ga0496119_0126972_657_1046 129
20 3300048925 Ga0496122_0001186 Ga0496122_0001186_16968_17357 129
21 3300048926 Ga0496123_0000698 Ga0496123_0000698_27551_27940 129
22 3300048928 Ga0496125_0137071 Ga0496125_0137071_28_459 129
23 3300050516 nmdc:mga0sz30_63636_c1 nmdc:mga0sz30_63636_c1_926_1315 129
24 iso_pu_bacteria 2919481497 2919482403 129
25 iso_pu_bacteria 2939589442 2939593225 129
26 iso_pu_bacteria 2974307012 2974308618 129
27 iso_pu_bacteria 2977247770 2977249361 129
28 iso_pu_bacteria 2984514374 2984516172 129
29 iso_pu_bacteria 2995948881 2995953580 129
30 iso_pu_bacteria 8056172158 8056174636 129
31 iso_pu_bacteria 8057529695 8057530042 129
32 3300025299 Ga0209256_1003652 Ga0209256_100365212 130
33 3300031548 Ga0307408_100000212 Ga0307408_10000021226 130
34 3300031901 Ga0307406_10000183 Ga0307406_1000018329 130
35 3300045049 Ga0466959_0464610 Ga0466959_0464610_124_567 130
36 3300046660 Ga0495625_0011460 Ga0495625_0011460_3340_3735 130
37 3300048924 Ga0496121_0558491 Ga0496121_0558491_266_658 130
38 3300053151 Ga0500604_0022083 Ga0500604_0022083_405_806 130
39 iso_pu_bacteria 2523231067 2523466589 130
40 iso_pu_bacteria 2599185188 2599502062 130
41 iso_pu_bacteria 2599185300 2599932878 130
42 iso_pu_bacteria 2643221628 2644159834 130
43 iso_pu_bacteria 2842718218 2842722146 130
44 iso_pu_bacteria 2852653556 2852653853 130
45 iso_pu_bacteria 2899924645 2899925666 130
46 iso_pu_bacteria 2928037797 2928038233 130
47 iso_pu_bacteria 2928044640 2928046162 130
48 iso_pu_bacteria 2928051484 2928053857 130
49 iso_pu_bacteria 2928064002 2928067403 130
50 3300006051 Ga0075364_10083255 Ga0075364_100832553 131
51 3300025302 Ga0207426_1051395 Ga0207426_10513953 131
52 3300042000 Ga0439437_046432 Ga0439437_046432_69_464 131
53 3300046507 Ga0495606_0006661 Ga0495606_0006661_4551_4964 131
54 iso_pu_bacteria 2599185214 2599624809 131
55 iso_pu_bacteria 2599185226 2599672821 131
56 iso_pu_bacteria 2599185227 2599682729 131
57 iso_pu_bacteria 2599185229 2599694430 131
58 iso_pu_bacteria 2643221557 2643803362 131
59 iso_pu_bacteria 2643221668 2644375006 131
60 iso_pu_bacteria 2885198086 2885203520 131
61 iso_pu_bacteria 2885211737 2885217130 131
62 iso_pu_bacteria 2904449895 2904453682 131
63 iso_pu_bacteria 2904456579 2904459011 131
64 iso_pu_bacteria 2928070936 2928074850 131
65 iso_pu_bacteria 2929520902 2929524268 131
66 iso_pu_bacteria 2945972063 2945972677 131
67 3300006038 Ga0075365_11287333 Ga0075365_112873331 132
68 3300006042 Ga0075368_10039159 Ga0075368_100391591 132
69 3300006048 Ga0075363_100060878 Ga0075363_1000608783 132
70 3300006051 Ga0075364_10480607 Ga0075364_104806071 132
71 3300006846 Ga0075430_100320697 Ga0075430_1003206971 132
72 3300025294 Ga0209025_1039648 Ga0209025_10396481 132
73 3300028794 Ga0307515_10540669 Ga0307515_105406692 132
74 3300031548 Ga0307408_101169810 Ga0307408_1011698101 132
75 3300042004 Ga0439445_0001714 Ga0439445_0001714_2958_3356 132
76 3300042004 Ga0439445_0029703 Ga0439445_0029703_933_1331 132
77 3300046512 Ga0495610_0002988 Ga0495610_0002988_7353_7751 132
78 3300046660 Ga0495625_0029553 Ga0495625_0029553_1346_1744 132
79 3300047320 Ga0495672_0001513 Ga0495672_0001513_3844_4242 132
80 3300050491 nmdc:mga00v17_421647_c1 nmdc:mga00v17_421647_c1_367_765 132
81 3300050491 nmdc:mga00v17_63376_c1 nmdc:mga00v17_63376_c1_1484_1882 132
82 3300050492 nmdc:mga0yw44_434661_c1 nmdc:mga0yw44_434661_c1_453_851 132
83 3300050494 nmdc:mga06z11_212151_c1 nmdc:mga06z11_212151_c1_619_1017 132
84 3300050495 nmdc:mga04h51_10922_c1 nmdc:mga04h51_10922_c1_1658_2056 132
85 3300053730 Ga0500645_019015 Ga0500645_019015_690_1088 132
86 iso_pu_bacteria 2941489479 2941491392 132
87 3300006178 Ga0075367_10030167 Ga0075367_100301674 133
88 3300006353 Ga0075370_10793020 Ga0075370_107930201 133
89 3300027866 Ga0209813_10178767 Ga0209813_101787672 133
90 3300041460 Ga0451802_1416109 Ga0451802_1416109_76_477 133
91 3300050494 nmdc:mga06z11_37064_c1 nmdc:mga06z11_37064_c1_1842_2243 133
92 3300050495 nmdc:mga04h51_206929_c1 nmdc:mga04h51_206929_c1_137_538 133
93 3300003792 Ga0055540_1088520 Ga0055540_10885201 134
94 3300005288 Ga0065714_10007550 Ga0065714_100075505 134
95 3300005289 Ga0065704_10276340 Ga0065704_102763402 134
96 3300005331 Ga0070670_101382724 Ga0070670_1013827241 134
97 3300006038 Ga0075365_10447309 Ga0075365_104473092 134
98 3300006048 Ga0075363_100003696 Ga0075363_1000036963 134
99 3300006048 Ga0075363_100006211 Ga0075363_1000062113 134
100 3300006051 Ga0075364_10000078 Ga0075364_100000787 134
101 3300006058 Ga0075432_10020422 Ga0075432_100204223 134
102 3300006881 Ga0068865_100422655 Ga0068865_1004226552 134
103 3300011119 Ga0105246_10146485 Ga0105246_101464852 134
104 3300013104 Ga0157370_11284214 Ga0157370_112842141 134
105 3300025263 Ga0209565_1024208 Ga0209565_10242081 134
106 3300025273 Ga0209673_1001396 Ga0209673_100139616 134
107 3300025298 Ga0209050_1017398 Ga0209050_10173983 134
108 3300025298 Ga0209050_1050535 Ga0209050_10505353 134
109 3300025303 Ga0209051_1027581 Ga0209051_10275813 134
110 3300025303 Ga0209051_1133122 Ga0209051_11331222 134
111 3300025304 Ga0209257_1000418 Ga0209257_100041863 134
112 3300025935 Ga0207709_10421894 Ga0207709_104218942 134
113 3300028794 Ga0307515_10033784 Ga0307515_100337845 134
114 3300031731 Ga0307405_10839096 Ga0307405_108390962 134
115 3300031824 Ga0307413_10086688 Ga0307413_100866882 134
116 3300031852 Ga0307410_10123029 Ga0307410_101230291 134
117 3300031903 Ga0307407_11342087 Ga0307407_113420871 134
118 3300031911 Ga0307412_10049757 Ga0307412_100497573 134
119 3300031995 Ga0307409_102505212 Ga0307409_1025052121 134
120 3300032005 Ga0307411_11057499 Ga0307411_110574991 134
121 3300041411 Ga0439466_0023044 Ga0439466_0023044_444_848 134
122 3300042122 Ga0450920_113625 Ga0450920_113625_127_531 134
123 3300042123 Ga0450921_007334 Ga0450921_007334_436_840 134
124 3300042127 Ga0450890_015304 Ga0450890_015304_301_705 134
125 3300042133 Ga0450896_009532 Ga0450896_009532_350_754 134
126 3300042134 Ga0450898_003127 Ga0450898_003127_1578_1982 134
127 3300042142 Ga0450905_001930 Ga0450905_001930_584_988 134
128 3300042184 Ga0450908_001912 Ga0450908_001912_2264_2668 134
129 3300042435 Ga0439434_0007982 Ga0439434_0007982_822_1226 134
130 3300042531 Ga0450918_002326 Ga0450918_002326_226_630 134
131 3300046660 Ga0495625_0000052 Ga0495625_0000052_124130_124534 134
132 3300046660 Ga0495625_0001579 Ga0495625_0001579_19612_20016 134
133 3300050489 nmdc:mga03683_45936_c2 nmdc:mga03683_45936_c2_824_1228 134
134 3300050490 nmdc:mga03n38_37987_c1 nmdc:mga03n38_37987_c1_1225_1629 134
135 3300050491 nmdc:mga00v17_14257_c1 nmdc:mga00v17_14257_c1_3883_4287 134
136 3300050491 nmdc:mga00v17_161_c1 nmdc:mga00v17_161_c1_4435_4839 134
137 3300050492 nmdc:mga0yw44_38763_c1 nmdc:mga0yw44_38763_c1_523_927 134
138 3300050493 nmdc:mga0k408_4257_c1 nmdc:mga0k408_4257_c1_5199_5603 134
139 3300050496 nmdc:mga07m45_163479_c1 nmdc:mga07m45_163479_c1_100_504 134
140 iso_pu_bacteria 2508501127 2509139618 134
141 iso_pu_bacteria 2597489875 2597810347 134
142 iso_pu_bacteria 2643221610 2644063729 134
143 iso_pu_bacteria 2643221675 2644414492 134
144 iso_pu_bacteria 2643221680 2644448020 134
145 iso_pu_bacteria 2643221726 2644690493 134
146 iso_pu_bacteria 2851182111 2851184841 134
147 iso_pu_bacteria 2919404418 2919405554 134
148 iso_pu_bacteria 2924754689 2924757625 134
149 iso_pu_bacteria 2970524798 2970525933 134
150 iso_pu_bacteria 2970540015 2970541629 134
151 iso_pu_bacteria 8004395343 8004400886 134
152 3300041404 Ga0439436_0118142 Ga0439436_0118142_64_471 135
153 3300053156 Ga0500622_0161864 Ga0500622_0161864_248_673 135
154 3300013104 Ga0157370_10313143 Ga0157370_103131432 136
155 3300025923 Ga0207681_10749238 Ga0207681_107492381 136
156 3300044901 Ga0466960_0100540 Ga0466960_0100540_437_889 136
157 3300048924 Ga0496121_0000119 Ga0496121_0000119_19005_19415 136
158 3300041410 Ga0439461_0139296 Ga0439461_0139296_88_501 137
159 3300042131 Ga0450894_074356 Ga0450894_074356_33_446 137
160 3300050489 nmdc:mga03683_16661_c2 nmdc:mga03683_16661_c2_1176_1589 137
161 3300050490 nmdc:mga03n38_37005_c1 nmdc:mga03n38_37005_c1_59_472 137
162 3300003578 Ga0006562J51391_1119062 Ga0006562J51391_11190623 138
163 3300003775 Ga0055524_1067694 Ga0055524_10676941 138
164 3300006186 Ga0075369_10335557 Ga0075369_103355572 138
165 3300006881 Ga0068865_100221172 Ga0068865_1002211722 138
166 3300025295 Ga0209564_1000013 Ga0209564_1000013420 138
167 3300025299 Ga0209256_1000042 Ga0209256_1000042268 138
168 3300025299 Ga0209256_1000745 Ga0209256_100074526 138
169 3300025304 Ga0209257_1069471 Ga0209257_10694711 138
170 3300025938 Ga0207704_10586207 Ga0207704_105862072 138
171 3300048929 Ga0496126_1268397 Ga0496126_1268397_29_451 138
172 3300053139 Ga0500568_0182496 Ga0500568_0182496_163_585 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

16

134

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pf5-assembly1.cif.gz_A structural genomics, protein yjgh 0.9386 4 131
3k0t-assembly1.cif.gz_B crystal structure of pspto -psp protein in complex with d-beta-glucose from pseudomonas syringae pv. tomato str. dc3000 0.9259 21 128
6l8p-assembly1.cif.gz_B crystal structure of rida from antarctic bacterium psychrobacter sp. pamc 21119 0.9223 21 128
1pf5-assembly1.cif.gz_A structural genomics, protein yjgh 0.9178 4 131
2dyy-assembly3.cif.gz_G crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii 0.9156 21 127
ID Description Score Start End Superfamily
af_Q9USQ7_300_402_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9438 24 127 3.30.1330.40
1pf5A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9386 4 131 3.30.1330.40
af_Q86KR5_2_129_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.924 21 129 3.30.1330.40
1pf5A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9178 4 131 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.917 22 127 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A238KT94-F1-model_v4 RutC family protein YjgH 0.9798 41 129 GO:0005829
GO:0019239
AF-A0A4Q3YCD2-F1-model_v4 RidA family protein 0.9751 41 130 GO:0005829
GO:0019239
AF-A0A7Z1GV87-F1-model_v4 Enamine deaminase RidA (YjgF/YER057c/UK114 family) 0.9749 30 130 GO:0005829
GO:0019239
AF-A0A0N1R118-F1-model_v4 Endoribonuclease L-PSP 0.9741 35 129 GO:0005829
GO:0019239
AF-A0A5U2FA85-F1-model_v4 RidA family protein 0.9735 37 129 GO:0005829
GO:0019239

Feature Viewer

pLDDT pTM Quality
88.66 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map