F261175

General Info

Members Datasets Scaffolds Average Seq Length
172 61 119 833

Family's Representative Sequence

Representative Sequence 3300042010|Ga0439452_000051|Ga0439452_000051_72502_75159
Length 885
Sequence MAMVFSSTGKLFRLQALGLSISLALGSTSIYAAEDIQFNMDVLDVNDRKNIDLSQFSRSGYIMPGMYTMTVHINNNELPEQTIHFYPPEDDPKGSMACLSAELVGQLGLKPEVVKTLTWWHQDACLNIDSLKGMEMRPDLATSALYLSIPQAYLEYASADWDPPSRWDEGIPGLLFDYNVNAQTQHQQRDGSRGYSVSGSGTAGVNMGAWRLRADWQGNLDHTTGSGQPTGKKLDWSRYYAYRAIPSLGSRLTLGEDYLNSSMFDSFRFTGASLVSDDNMLPPNLRGYAPEVVGMAKTNAKVIISQQGRVLYETQVAAGPFRIQDLNDAVSGELNVRVEEQDGSVQEFTMNTASIPYLTRPGSVRFKFAAGKPSDWEHHSRGPLFGTGEFSWGVSNGWSLYGGALMGGDYNALSLGIGRDLMAFGALSFDATQSRARIPSEDGALSGGSYRLSYSKTFDELDSQVTFAGYRFSEENFMSMGEYLDARYYGNRVGGSKEMYTITFNKQFRDLGLSSYLNYSHQTYWDRPANDRYNLTMSRYFDIGRFKNLSVSLSAYRNRYNDTNDDGMYLSLSMPWGNGANVSYNATVNRNDTTHRVGYYDRLDENNNYQLAMGTSRSGANASGYYNHEGDMARVSANASYQEGRYSAVGFSAQGGATLTPEGGALHRVGMMGGTRMLLDTEGVAGVPVRGYGATTKTNAWGKAVVADVNSYYRNKASIDLNKLGEKAEATKSVVQATLTEGAIGYRKFGVIAGEKAMAIIKLADGSTPPFGATVVNGRKQETGIVNDGGSVYLSGINAGDSMTVHWNGAAQCEVRLPTPLPADMMNSLLLPCLPVSGPIDNPAAAPVALGTEKIPVAIPASGRVTKNKMLLEPLAAEAEYEATL

Samples

Sample ID Description Type Environment
1 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
2 2506520008 Serratia plymuthica AS12 Isolate Unclassified
3 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
4 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
5 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
6 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
7 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
8 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
9 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
10 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
11 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
12 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
13 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
14 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
15 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
16 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
17 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
18 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
19 2932406140 Serratia sp. 2723 Isolate Rhizosphere
20 2937967321 Serratia sp. YC16 Isolate Unclassified
21 2939577877 Serratia sp. 509 Isolate Rhizosphere
22 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
25 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
26 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
27 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
31 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
32 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
33 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
39 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
40 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
41 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
42 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
43 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
44 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
45 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
46 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
47 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
48 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
49 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
50 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
51 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
52 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
53 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
54 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
55 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
56 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
57 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
58 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
59 640753048 Serratia proteamaculans 568 Isolate Endosphere
60 8004592986 Serratia sp. S119 Isolate Unclassified
61 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 70.93
Metatranscriptomes 0
Isolates 29.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.16
Nodule 2.33
Rhizoplane 0.58
Rhizosphere 54.07
Stem 0
Stem Tuber 0
Unclassified 41.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058692_1000365 3300003856 Bacteria 21773
2 Ga0058692_1001975 3300003856 Bacteria 7142
3 Ga0065704_10077312 3300005289 Bacteria 4737
4 Ga0079104_1000102 3300006946 Bacteria 124752
5 Ga0079104_1002670 3300006946 Bacteria 9225
6 Ga0105251_10000203 3300009011 Bacteria 59939
7 Ga0105251_10000408 3300009011 Bacteria 41748
8 Ga0105251_10000555 3300009011 Bacteria 35011
9 Ga0105251_10000808 3300009011 Bacteria 28348
10 Ga0105251_10000984 3300009011 Bacteria 25103
11 Ga0105251_10001344 3300009011 Bacteria 21212
12 Ga0105251_10001419 3300009011 Bacteria 20645
13 Ga0105251_10004140 3300009011 Bacteria 10111
14 Ga0105251_10005527 3300009011 Bacteria 8230
15 Ga0105251_10007321 3300009011 Bacteria 6826
16 Ga0105251_10009052 3300009011 Bacteria 5929
17 Ga0105251_10015299 3300009011 Bacteria 4201
18 Ga0105244_10000767 3300009036 Bacteria 27440
19 Ga0105244_10002338 3300009036 Bacteria 14406
20 Ga0105244_10002733 3300009036 Bacteria 13170
21 Ga0105250_10003000 3300009092 Bacteria 8180
22 Ga0105250_10006864 3300009092 Bacteria 4938
23 Ga0105247_10000733 3300009101 Bacteria 25545
24 Ga0105241_10000004 3300009174 Bacteria 803007
25 Ga0105241_10000006 3300009174 Bacteria 373608
26 Ga0105241_10014974 3300009174 Bacteria 5680
27 Ga0157373_10014878 3300013100 Bacteria 5698
28 Ga0157371_10000006 3300013102 Bacteria 404774
29 Ga0163161_10000001 3300017792 Bacteria 2041488
30 Ga0163161_10000028 3300017792 Bacteria 197151
31 Ga0207696_1000068 3300025711 Bacteria 228017
32 Ga0207696_1002363 3300025711 Bacteria 9330
33 Ga0207655_1000048 3300025728 Bacteria 299024
34 Ga0207655_1000172 3300025728 Bacteria 118773
35 Ga0207655_1001440 3300025728 Bacteria 22057
36 Ga0207713_1000004 3300025735 Bacteria 702781
37 Ga0207713_1000044 3300025735 Bacteria 238074
38 Ga0207713_1000139 3300025735 Bacteria 110486
39 Ga0207713_1000476 3300025735 Bacteria 41788
40 Ga0207713_1000825 3300025735 Bacteria 28675
41 Ga0207713_1001371 3300025735 Bacteria 19820
42 Ga0207713_1003172 3300025735 Bacteria 11383
43 Ga0207713_1003686 3300025735 Bacteria 10303
44 Ga0207713_1004276 3300025735 Bacteria 9312
45 Ga0207713_1005729 3300025735 Bacteria 7702
46 Ga0207713_1009204 3300025735 Bacteria 5593
47 Ga0207710_10000145 3300025900 Bacteria 80941
48 Ga0207654_10000006 3300025911 Bacteria 815027
49 Ga0207654_10000008 3300025911 Bacteria 375871
50 Ga0207654_10006998 3300025911 Bacteria 5680
51 Ga0209281_1000124 3300027111 Bacteria 202831
52 Ga0209281_1001372 3300027111 Bacteria 14988
53 Ga0209371_1000126 3300027312 Bacteria 127214
54 Ga0209371_1003566 3300027312 Bacteria 7463
55 Ga0268256_1000105 3300030500 Bacteria 126344
56 Ga0268256_1003398 3300030500 Bacteria 7193
57 Ga0439466_0001106 3300041411 Bacteria 10492
58 Ga0439432_002814 3300042006 Bacteria 6485
59 Ga0439432_013561 3300042006 Bacteria 2770
60 Ga0439452_000051 3300042010 Bacteria 117632
61 Ga0466981_0000019 3300044669 Bacteria 91861
62 Ga0495627_000028 3300046453 Bacteria 234737
63 Ga0495627_000100 3300046453 Bacteria 106276
64 Ga0495605_0000143 3300046474 Bacteria 92603
65 Ga0495654_0000127 3300046530 Bacteria 84749
66 Ga0495654_0000584 3300046530 Bacteria 29272
67 Ga0495589_0000005 3300046794 Bacteria 405112
68 Ga0496116_0000077 3300048919 Bacteria 227959
69 Ga0496116_0000124 3300048919 Bacteria 161207
70 Ga0496116_0000187 3300048919 Bacteria 123291
71 Ga0496116_0000325 3300048919 Bacteria 78155
72 Ga0496116_0003531 3300048919 Bacteria 15393
73 Ga0496116_0009278 3300048919 Bacteria 8411
74 Ga0496117_0000945 3300048920 Bacteria 44443
75 Ga0496117_0001792 3300048920 Bacteria 29238
76 Ga0496117_0006369 3300048920 Bacteria 11993
77 Ga0496117_0014075 3300048920 Bacteria 6919
78 Ga0496118_0000747 3300048921 Bacteria 52609
79 Ga0496118_0002917 3300048921 Bacteria 22211
80 Ga0496118_0003216 3300048921 Bacteria 20854
81 Ga0496118_0005813 3300048921 Bacteria 13828
82 Ga0496118_0017144 3300048921 Bacteria 6608
83 Ga0496119_0000052 3300048922 Bacteria 183922
84 Ga0496119_0000075 3300048922 Bacteria 146247
85 Ga0496119_0000183 3300048922 Bacteria 87876
86 Ga0496119_0000195 3300048922 Bacteria 85376
87 Ga0496119_0000638 3300048922 Bacteria 47218
88 Ga0496119_0000904 3300048922 Bacteria 38639
89 Ga0496119_0001099 3300048922 Bacteria 34061
90 Ga0496119_0001149 3300048922 Bacteria 33224
91 Ga0496119_0001480 3300048922 Bacteria 28141
92 Ga0496119_0004693 3300048922 Bacteria 13454
93 Ga0496119_0010115 3300048922 Bacteria 7969
94 Ga0496120_0000008 3300048923 Bacteria 404544
95 Ga0496120_0000052 3300048923 Bacteria 186071
96 Ga0496120_0000095 3300048923 Bacteria 145908
97 Ga0496120_0000205 3300048923 Bacteria 101562
98 Ga0496120_0000366 3300048923 Bacteria 73355
99 Ga0496120_0000748 3300048923 Bacteria 47163
100 Ga0496120_0000763 3300048923 Bacteria 46492
101 Ga0496120_0004340 3300048923 Bacteria 11979
102 Ga0496121_0000695 3300048924 Bacteria 62684
103 Ga0496121_0006512 3300048924 Bacteria 14442
104 Ga0496122_0000069 3300048925 Bacteria 223795
105 Ga0496122_0002801 3300048925 Bacteria 23943
106 Ga0496122_0012453 3300048925 Bacteria 8464
107 Ga0496122_0014095 3300048925 Bacteria 7757
108 Ga0496123_0000071 3300048926 Bacteria 199821
109 Ga0496123_0002300 3300048926 Bacteria 23983
110 Ga0496123_0005493 3300048926 Bacteria 12744
111 Ga0496123_0010930 3300048926 Bacteria 7941
112 Ga0496124_0000008 3300048927 Bacteria 864372
113 Ga0496124_0000017 3300048927 Bacteria 444389
114 Ga0496124_0000931 3300048927 Bacteria 47196
115 Ga0496124_0008409 3300048927 Bacteria 10792
116 Ga0496124_0009463 3300048927 Bacteria 10033
117 Ga0496124_0014746 3300048927 Bacteria 7542
118 Ga0496125_0006958 3300048928 Bacteria 12113
119 Ga0496125_0009432 3300048928 Bacteria 10023

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2881609920 2881614184 698
2 iso_pu_bacteria 2869551831 2869555076 727
3 iso_pu_bacteria 2844665904 2844669856 754
4 iso_pu_bacteria 2937967321 2937968973 755
5 iso_pu_bacteria 8004592986 8004596655 766
6 3300009036 Ga0105244_10000767 Ga0105244_1000076724 777
7 3300025728 Ga0207655_1000172 Ga0207655_100017223 777
8 3300006946 Ga0079104_1000102 Ga0079104_100010277 790
9 3300027111 Ga0209281_1000124 Ga0209281_1000124146 790
10 3300009011 Ga0105251_10015299 Ga0105251_100152993 791
11 3300046453 Ga0495627_000100 Ga0495627_000100_81555_84023 791
12 3300009036 Ga0105244_10002338 Ga0105244_1000233814 797
13 3300025728 Ga0207655_1000048 Ga0207655_1000048260 797
14 3300048924 Ga0496121_0000695 Ga0496121_0000695_17950_20487 800
15 3300048925 Ga0496122_0002801 Ga0496122_0002801_11250_13787 800
16 3300048926 Ga0496123_0002300 Ga0496123_0002300_11290_13827 800
17 3300017792 Ga0163161_10000028 Ga0163161_1000002816 803
18 3300009092 Ga0105250_10003000 Ga0105250_100030008 805
19 3300009011 Ga0105251_10001419 Ga0105251_1000141916 807
20 3300009036 Ga0105244_10002733 Ga0105244_100027337 807
21 3300025728 Ga0207655_1001440 Ga0207655_100144022 807
22 3300025735 Ga0207713_1003172 Ga0207713_10031723 807
23 3300048919 Ga0496116_0000187 Ga0496116_0000187_113270_115768 807
24 3300048919 Ga0496116_0000325 Ga0496116_0000325_64656_67175 807
25 3300048921 Ga0496118_0000747 Ga0496118_0000747_33402_35978 807
26 3300048922 Ga0496119_0001149 Ga0496119_0001149_3156_5675 808
27 3300048923 Ga0496120_0000095 Ga0496120_0000095_29131_31650 808
28 3300006946 Ga0079104_1002670 Ga0079104_10026707 809
29 3300027111 Ga0209281_1001372 Ga0209281_10013725 809
30 3300046453 Ga0495627_000028 Ga0495627_000028_157946_160441 809
31 iso_pu_bacteria 2888366609 2888368207 811
32 3300013102 Ga0157371_10000006 Ga0157371_1000000626 812
33 3300009011 Ga0105251_10000984 Ga0105251_1000098417 813
34 3300025735 Ga0207713_1009204 Ga0207713_10092045 813
35 iso_pu_bacteria 2888366609 2888366933 813
36 3300048919 Ga0496116_0000124 Ga0496116_0000124_82319_84892 816
37 3300048922 Ga0496119_0000183 Ga0496119_0000183_80395_82968 816
38 3300048923 Ga0496120_0000095 Ga0496120_0000095_118907_121480 816
39 3300046474 Ga0495605_0000143 Ga0495605_0000143_69176_71728 817
40 3300009092 Ga0105250_10006864 Ga0105250_100068644 820
41 3300009101 Ga0105247_10000733 Ga0105247_1000073311 820
42 3300025711 Ga0207696_1000068 Ga0207696_100006848 820
43 3300025900 Ga0207710_10000145 Ga0207710_1000014516 820
44 3300048919 Ga0496116_0000077 Ga0496116_0000077_55227_57773 820
45 3300048920 Ga0496117_0001792 Ga0496117_0001792_5063_7609 820
46 3300048921 Ga0496118_0003216 Ga0496118_0003216_6898_9444 820
47 3300009011 Ga0105251_10007321 Ga0105251_100073216 821
48 3300009174 Ga0105241_10014974 Ga0105241_100149743 821
49 3300013100 Ga0157373_10014878 Ga0157373_100148784 821
50 3300041411 Ga0439466_0001106 Ga0439466_0001106_2145_4643 821
51 3300048922 Ga0496119_0000904 Ga0496119_0000904_13001_15508 822
52 3300048923 Ga0496120_0000763 Ga0496120_0000763_15673_18180 822
53 iso_pu_bacteria 2869551831 2869552982 822
54 3300017792 Ga0163161_10000001 Ga0163161_1000000151 824
55 iso_pu_bacteria 2884086401 2884088529 825
56 3300048922 Ga0496119_0000052 Ga0496119_0000052_141859_144411 827
57 3300048923 Ga0496120_0000008 Ga0496120_0000008_254907_257459 827
58 3300009011 Ga0105251_10009052 Ga0105251_100090524 828
59 3300009174 Ga0105241_10000004 Ga0105241_10000004481 828
60 3300025735 Ga0207713_1000004 Ga0207713_1000004386 828
61 3300042006 Ga0439432_013561 Ga0439432_013561_84_2579 828
62 3300048922 Ga0496119_0000638 Ga0496119_0000638_39177_41708 829
63 3300048923 Ga0496120_0000748 Ga0496120_0000748_5456_7987 829
64 3300048927 Ga0496124_0000931 Ga0496124_0000931_39177_41708 829
65 iso_pu_bacteria 2891670763 2891670806 829
66 iso_pu_bacteria 2711768156 2712471337 831
67 3300009011 Ga0105251_10000555 Ga0105251_1000055521 832
68 3300009011 Ga0105251_10004140 Ga0105251_1000414010 832
69 3300009011 Ga0105251_10005527 Ga0105251_100055272 832
70 3300009174 Ga0105241_10000006 Ga0105241_10000006250 832
71 3300025711 Ga0207696_1002363 Ga0207696_10023638 832
72 3300025735 Ga0207713_1001371 Ga0207713_10013719 832
73 3300025735 Ga0207713_1003686 Ga0207713_10036863 832
74 3300025735 Ga0207713_1004276 Ga0207713_10042765 832
75 3300042006 Ga0439432_002814 Ga0439432_002814_1792_4317 832
76 3300048919 Ga0496116_0009278 Ga0496116_0009278_5091_7607 832
77 3300048920 Ga0496117_0014075 Ga0496117_0014075_2542_5052 832
78 3300048921 Ga0496118_0017144 Ga0496118_0017144_1208_3724 832
79 3300048922 Ga0496119_0010115 Ga0496119_0010115_4785_7301 832
80 3300048924 Ga0496121_0006512 Ga0496121_0006512_9396_11906 832
81 3300048925 Ga0496122_0012453 Ga0496122_0012453_3562_6078 832
82 3300048925 Ga0496122_0014095 Ga0496122_0014095_2856_5372 832
83 3300048926 Ga0496123_0005493 Ga0496123_0005493_2856_5372 832
84 3300048926 Ga0496123_0010930 Ga0496123_0010930_2387_4903 832
85 3300048927 Ga0496124_0008409 Ga0496124_0008409_4970_7486 832
86 3300048927 Ga0496124_0009463 Ga0496124_0009463_6529_9030 832
87 3300048927 Ga0496124_0014746 Ga0496124_0014746_5000_7516 832
88 3300048928 Ga0496125_0009432 Ga0496125_0009432_5105_7621 832
89 iso_pu_bacteria 8004592986 8004595143 832
90 iso_pu_bacteria 2869551831 2869553014 833
91 iso_pu_bacteria 2908669403 2908674152 833
92 3300009011 Ga0105251_10000203 Ga0105251_1000020345 834
93 3300025735 Ga0207713_1000825 Ga0207713_100082520 834
94 3300048919 Ga0496116_0003531 Ga0496116_0003531_3114_5759 834
95 3300048920 Ga0496117_0000945 Ga0496117_0000945_38676_41321 834
96 3300048921 Ga0496118_0002917 Ga0496118_0002917_15985_18630 834
97 iso_pu_bacteria 2772190666 2772440410 836
98 iso_pu_bacteria 2869551831 2869552142 836
99 iso_pu_bacteria 8015394850 8015395861 836
100 3300048922 Ga0496119_0000195 Ga0496119_0000195_51652_54174 837
101 3300048923 Ga0496120_0000205 Ga0496120_0000205_45776_48298 837
102 3300048927 Ga0496124_0000008 Ga0496124_0000008_810199_812721 837
103 iso_pu_bacteria 2654587920 2656276758 837
104 iso_pu_bacteria 2687453601 2689447474 837
105 iso_pu_bacteria 2869551831 2869556277 837
106 iso_pu_bacteria 2932406140 2932410266 837
107 iso_pu_bacteria 2939577877 2939582157 837
108 iso_pu_bacteria 640753048 640940289 837
109 3300048920 Ga0496117_0006369 Ga0496117_0006369_5910_8453 838
110 3300048921 Ga0496118_0005813 Ga0496118_0005813_5910_8453 838
111 3300048922 Ga0496119_0004693 Ga0496119_0004693_5912_8455 838
112 3300048923 Ga0496120_0004340 Ga0496120_0004340_3697_6240 838
113 3300048928 Ga0496125_0006958 Ga0496125_0006958_5720_8263 838
114 iso_pu_bacteria 2506520007 2506580923 838
115 iso_pu_bacteria 2506520008 2506586062 838
116 iso_pu_bacteria 2667528172 2671105095 838
117 iso_pu_bacteria 2772190666 2772438189 838
118 iso_pu_bacteria 2937967321 2937969929 838
119 iso_pu_bacteria 8004592986 8004597501 838
120 iso_pu_bacteria 8015394850 8015398212 838
121 iso_pu_bacteria 2508501071 2508851301 839
122 iso_pu_bacteria 2654587920 2656275245 839
123 iso_pu_bacteria 2654587920 2656275733 839
124 iso_pu_bacteria 2654587920 2656278100 839
125 iso_pu_bacteria 2687453601 2689443616 839
126 iso_pu_bacteria 2687453601 2689443823 839
127 iso_pu_bacteria 2772190666 2772437454 839
128 iso_pu_bacteria 2772190666 2772439704 839
129 iso_pu_bacteria 2806310673 2807180399 839
130 iso_pu_bacteria 2937967321 2937968343 839
131 iso_pu_bacteria 2508501071 2508854139 840
132 iso_pu_bacteria 2806310673 2807180217 840
133 iso_pu_bacteria 2888373701 2888375676 840
134 iso_pu_bacteria 640753048 640939706 840
135 iso_pu_bacteria 8004592986 8004593687 840
136 3300025735 Ga0207713_1000044 Ga0207713_100004451 841
137 3300046794 Ga0495589_0000005 Ga0495589_0000005_22531_25065 841
138 3300048922 Ga0496119_0000075 Ga0496119_0000075_130248_132788 841
139 3300048923 Ga0496120_0000008 Ga0496120_0000008_155317_157857 841
140 iso_pu_bacteria 2932406140 2932408976 841
141 iso_pu_bacteria 2932406140 2932409644 841
142 iso_pu_bacteria 2939577877 2939580600 841
143 iso_pu_bacteria 2939577877 2939581720 841
144 3300009011 Ga0105251_10000408 Ga0105251_1000040838 842
145 3300025735 Ga0207713_1000476 Ga0207713_100047638 842
146 3300048922 Ga0496119_0001099 Ga0496119_0001099_22825_25359 842
147 3300048922 Ga0496119_0001480 Ga0496119_0001480_6182_8716 842
148 3300048923 Ga0496120_0000052 Ga0496120_0000052_16494_19028 842
149 3300048923 Ga0496120_0000366 Ga0496120_0000366_9481_12015 842
150 3300048925 Ga0496122_0000069 Ga0496122_0000069_209446_211983 842
151 3300048926 Ga0496123_0000071 Ga0496123_0000071_11813_14350 842
152 3300048927 Ga0496124_0000017 Ga0496124_0000017_94992_97526 842
153 3300009011 Ga0105251_10001344 Ga0105251_100013443 843
154 3300025911 Ga0207654_10000006 Ga0207654_10000006498 843
155 iso_pu_bacteria 2846540461 2846541368 843
156 3300025735 Ga0207713_1000139 Ga0207713_100013930 844
157 3300025911 Ga0207654_10000008 Ga0207654_10000008253 844
158 3300042010 Ga0439452_000051 Ga0439452_000051_72502_75159 844
159 3300046530 Ga0495654_0000127 Ga0495654_0000127_15478_18054 844
160 3300003856 Ga0058692_1001975 Ga0058692_10019753 845
161 3300005289 Ga0065704_10077312 Ga0065704_100773121 845
162 3300009011 Ga0105251_10000808 Ga0105251_1000080815 845
163 3300025735 Ga0207713_1005729 Ga0207713_10057297 845
164 3300025911 Ga0207654_10006998 Ga0207654_100069984 845
165 3300027312 Ga0209371_1003566 Ga0209371_10035666 845
166 3300030500 Ga0268256_1003398 Ga0268256_10033984 845
167 3300046530 Ga0495654_0000584 Ga0495654_0000584_2530_5088 845
168 3300044669 Ga0466981_0000019 Ga0466981_0000019_85856_88405 846
169 3300046530 Ga0495654_0000127 Ga0495654_0000127_52122_54743 848
170 3300003856 Ga0058692_1000365 Ga0058692_100036517 855
171 3300027312 Ga0209371_1000126 Ga0209371_100012663 855
172 3300030500 Ga0268256_1000105 Ga0268256_100010562 855

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00577

Usher

Outer membrane usher protein

198

749

0.96

PF13954

PapC_N

PapC N-terminal domain

37

182

0.95

PF13953

PapC_C

PapC C-terminal domain

758

820

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l48-assembly3.cif.gz_C crystal structure of the c-terminal domain of the papc usher 0.9673 765 842
3l48-assembly5.cif.gz_E crystal structure of the c-terminal domain of the papc usher 0.9563 764 842
3l48-assembly5.cif.gz_E crystal structure of the c-terminal domain of the papc usher 0.9332 764 842
3fcg-assembly1.cif.gz_A crystal structure analysis of the middle domain of the caf1a usher 0.9211 297 360
3l48-assembly3.cif.gz_C crystal structure of the c-terminal domain of the papc usher 0.8588 765 842
ID Description Score Start End Superfamily
af_P77196_673_764_2.60.40.2610 Mainly Beta;Sandwich;Immunoglobulin-like;Outer membrane usher protein FimD, plug domain 0.9988 674 763 2.60.40.2610
af_P77196_673_764_2.60.40.2610 Mainly Beta;Sandwich;Immunoglobulin-like;Outer membrane usher protein FimD, plug domain 0.9666 674 763 2.60.40.2610
af_P77196_768_845_2.60.40.2070 Mainly Beta;Sandwich;Immunoglobulin-like;PapC, C-terminal domain 0.9651 768 842 2.60.40.2070
3l48E01 Mainly Beta;Sandwich;Immunoglobulin-like;PapC, C-terminal domain 0.9474 768 842 2.60.40.2070
2gr8F00 Alpha Beta;2-Layer Sandwich;Pantoate--beta-alanine Ligase; Chain: A,domain 2;GSPII I/J protein-like 0.9473 588 631 3.30.1300.30
ID Description Score Start End GO Terms
AF-A0A447S0K2-F1-model_v4 Fimbrial protein SteB 0.9615 686 809 GO:0009279
GO:0009297
GO:0015473
AF-A0A4U2KGP7-F1-model_v4 deleted 0.9607 367 499
AF-A0A376KLU4-F1-model_v4 Fimbrial usher protein PixC 0.9538 425 843 GO:0009279
GO:0009297
GO:0015473
AF-A0A5N9VY52-F1-model_v4 deleted 0.9483 721 818
AF-A0A4U2KGP7-F1-model_v4 deleted 0.9468 367 499

Feature Viewer

pLDDT pTM Quality
77.63 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map