F260179

General Info

Members Datasets Scaffolds Average Seq Length
172 112 344 139

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_101235449|Ga0070669_1012354491
Length 140
Sequence MADFKYGDITEKIIGASFRVHSALGNGFQEVIYQRALELEFKIMPLDYSREFEMPIYYLDQHIGTRRVDLLVDGKISVELKAIIKLEDVHLAQAMNLEAHNLEIGLLINFGSKRLEFHRFTNKKHNPNIIQHPIKSQSSH

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
52 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
85 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
86 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
91 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
92 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
93 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
99 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
100 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
101 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
102 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
103 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
104 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
105 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
106 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
107 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
108 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
109 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
110 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
111 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
112 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.33
Nodule 0
Rhizoplane 1.16
Rhizosphere 94.19
Stem 0
Stem Tuber 0
Unclassified 18.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_101235449 3300005353 Unclassified 646
2 JGI24740J21852_10042683 3300001979 Unclassified 1358
3 Ga0065712_10215903 3300005290 Unclassified 1057
4 Ga0070683_100189051 3300005329 Bacteria 1955
5 Ga0070670_100034120 3300005331 Bacteria 4380
6 Ga0070670_100084469 3300005331 Bacteria 2727
7 Ga0070670_100259146 3300005331 Unclassified 1516
8 Ga0070677_10368655 3300005333 Bacteria 749
9 Ga0068869_100028450 3300005334 Bacteria 3906
10 Ga0068869_101054485 3300005334 Bacteria 710
11 Ga0068869_101990886 3300005334 Bacteria 521
12 Ga0070689_101214951 3300005340 Bacteria 677
13 Ga0070689_101604492 3300005340 Bacteria 591
14 Ga0070668_100026058 3300005347 Bacteria 4434
15 Ga0070669_100394404 3300005353 Bacteria 1131
16 Ga0070669_100526968 3300005353 Bacteria 983
17 Ga0070669_100778154 3300005353 Bacteria 812
18 Ga0070671_100157174 3300005355 Bacteria 1921
19 Ga0070671_101436527 3300005355 Bacteria 610
20 Ga0070673_100894603 3300005364 Unclassified 823
21 Ga0070673_100941744 3300005364 Unclassified 802
22 Ga0070659_100033996 3300005366 Bacteria 3964
23 Ga0070667_100054456 3300005367 Bacteria 3378
24 Ga0070667_101631617 3300005367 Bacteria 606
25 Ga0070711_101327014 3300005439 Bacteria 625
26 Ga0070700_100294902 3300005441 Bacteria 1181
27 Ga0070700_100786759 3300005441 Bacteria 765
28 Ga0070679_100170887 3300005530 Bacteria 2147
29 Ga0068853_100049510 3300005539 Unclassified 3611
30 Ga0068853_100345499 3300005539 Bacteria 1383
31 Ga0068853_100891107 3300005539 Bacteria 854
32 Ga0070672_100443041 3300005543 Bacteria 1118
33 Ga0070664_101554639 3300005564 Unclassified 626
34 Ga0068854_101146014 3300005578 Bacteria 695
35 Ga0068854_101337163 3300005578 Bacteria 646
36 Ga0068856_100421801 3300005614 Bacteria 1354
37 Ga0070702_101058960 3300005615 Bacteria 646
38 Ga0068852_100136202 3300005616 Bacteria 2267
39 Ga0068852_100254253 3300005616 Bacteria 1684
40 Ga0068852_100633305 3300005616 Bacteria 1076
41 Ga0068852_102053366 3300005616 Unclassified 594
42 Ga0068859_100067422 3300005617 Bacteria 3613
43 Ga0068859_101161936 3300005617 Bacteria 850
44 Ga0068859_102492065 3300005617 Bacteria 570
45 Ga0068864_100026175 3300005618 Bacteria 4918
46 Ga0068864_100299389 3300005618 Bacteria 1505
47 Ga0068861_100912625 3300005719 Unclassified 833
48 Ga0068851_10000112 3300005834 Bacteria 42962
49 Ga0068851_10688166 3300005834 Unclassified 628
50 Ga0068863_100005620 3300005841 Bacteria 12322
51 Ga0068863_100528015 3300005841 Bacteria 1164
52 Ga0068863_101288252 3300005841 Unclassified 737
53 Ga0068863_101308996 3300005841 Bacteria 731
54 Ga0068860_100121868 3300005843 Bacteria 2497
55 Ga0068862_100003779 3300005844 Bacteria 12914
56 Ga0068862_101692387 3300005844 Bacteria 641
57 Ga0075366_10282811 3300006195 Bacteria 1014
58 Ga0068871_100887931 3300006358 Bacteria 826
59 Ga0097620_100067425 3300006931 Bacteria 3613
60 Ga0097620_101162025 3300006931 Bacteria 850
61 Ga0097620_102491943 3300006931 Bacteria 570
62 Ga0105240_10657312 3300009093 Bacteria 1148
63 Ga0111539_10808244 3300009094 Bacteria 1091
64 Ga0105242_10077401 3300009176 Bacteria 2775
65 Ga0105242_10684433 3300009176 Unclassified 1001
66 Ga0105237_10020135 3300009545 Bacteria 6886
67 Ga0105249_10030312 3300009553 Bacteria 4890
68 Ga0105249_10111257 3300009553 Bacteria 2589
69 Ga0105249_11354511 3300009553 Bacteria 783
70 Ga0105249_11690348 3300009553 Bacteria 705
71 Ga0105239_10036577 3300010375 Bacteria 5390
72 Ga0157371_10053812 3300013102 Bacteria 2858
73 Ga0157371_10444381 3300013102 Bacteria 953
74 Ga0157371_10450909 3300013102 Bacteria 946
75 Ga0157371_10550908 3300013102 Bacteria 855
76 Ga0157374_10364093 3300013296 Bacteria 1438
77 Ga0157374_10654697 3300013296 Unclassified 1062
78 Ga0157378_10090028 3300013297 Unclassified 2788
79 Ga0157378_10833102 3300013297 Bacteria 950
80 Ga0157378_11440700 3300013297 Bacteria 732
81 Ga0163162_11616371 3300013306 Bacteria 739
82 Ga0157372_10247983 3300013307 Bacteria 2067
83 Ga0157372_10273116 3300013307 Bacteria 1965
84 Ga0157372_10699722 3300013307 Bacteria 1179
85 Ga0157372_12136727 3300013307 Bacteria 643
86 Ga0157372_12549238 3300013307 Unclassified 587
87 Ga0157375_11617160 3300013308 Bacteria 766
88 Ga0157380_10559225 3300014326 Bacteria 1124
89 Ga0157377_11222713 3300014745 Unclassified 583
90 Ga0157379_10639263 3300014968 Unclassified 995
91 Ga0157379_11417697 3300014968 Bacteria 674
92 Ga0157376_10617840 3300014969 Unclassified 1080
93 Ga0213876_10274529 3300021384 Bacteria 896
94 Ga0207426_1000030 3300025302 Bacteria 461478
95 Ga0207656_10000113 3300025321 Bacteria 31020
96 Ga0207682_10073608 3300025893 Bacteria 1451
97 Ga0207671_11152506 3300025914 Bacteria 608
98 Ga0207660_10441357 3300025917 Bacteria 1052
99 Ga0207657_10027751 3300025919 Bacteria 5179
100 Ga0207652_10483173 3300025921 Bacteria 1115
101 Ga0207681_10239015 3300025923 Bacteria 1413
102 Ga0207681_10314018 3300025923 Bacteria 1244
103 Ga0207681_10674530 3300025923 Unclassified 858
104 Ga0207681_10736583 3300025923 Unclassified 821
105 Ga0207681_11228504 3300025923 Bacteria 629
106 Ga0207650_10535372 3300025925 Unclassified 981
107 Ga0207650_10613030 3300025925 Unclassified 916
108 Ga0207659_10063892 3300025926 Bacteria 2663
109 Ga0207644_10101945 3300025931 Bacteria 2158
110 Ga0207690_10040579 3300025932 Bacteria 3044
111 Ga0207670_11077471 3300025936 Bacteria 678
112 Ga0207691_10392148 3300025940 Unclassified 1184
113 Ga0207691_10704370 3300025940 Unclassified 851
114 Ga0207689_10069790 3300025942 Bacteria 2887
115 Ga0207661_10279077 3300025944 Bacteria 1493
116 Ga0207651_10037551 3300025960 Bacteria 3175
117 Ga0207712_10651500 3300025961 Bacteria 915
118 Ga0207668_10081892 3300025972 Bacteria 2343
119 Ga0207640_10553504 3300025981 Bacteria 967
120 Ga0207658_10305493 3300025986 Unclassified 1372
121 Ga0207677_10173116 3300026023 Bacteria 1690
122 Ga0207639_10076041 3300026041 Bacteria 2642
123 Ga0207639_10328546 3300026041 Bacteria 1360
124 Ga0207708_10106777 3300026075 Bacteria 2171
125 Ga0207702_10271784 3300026078 Bacteria 1599
126 Ga0207641_10000013 3300026088 Bacteria 341378
127 Ga0207641_10475078 3300026088 Bacteria 1211
128 Ga0207641_11463546 3300026088 Bacteria 684
129 Ga0207648_11302017 3300026089 Bacteria 683
130 Ga0207676_10034551 3300026095 Bacteria 3829
131 Ga0207676_10174285 3300026095 Bacteria 1877
132 Ga0207674_10035446 3300026116 Bacteria 5206
133 Ga0207674_10140593 3300026116 Bacteria 2373
134 Ga0207675_102089821 3300026118 Bacteria 583
135 Ga0207698_11252302 3300026142 Unclassified 756
136 Ga0207698_11574116 3300026142 Unclassified 673
137 Ga0268265_10060000 3300028380 Bacteria 2913
138 Ga0268265_11401838 3300028380 Bacteria 701
139 Ga0268264_10015087 3300028381 Bacteria 6337
140 Ga0265323_10216064 3300028653 Unclassified 601
141 Ga0265322_10000391 3300028654 Bacteria 18201
142 Ga0307515_10002910 3300028794 Bacteria 36374
143 Ga0265331_10197313 3300031250 Bacteria 907
144 Ga0265327_10066390 3300031251 Bacteria 1821
145 Ga0436365_0320654 3300039437 Bacteria 1406
146 Ga0436365_1719163 3300039437 Bacteria 1089
147 Ga0451800_1485929 3300041459 Unclassified 811
148 Ga0451807_2090069 3300041486 Unclassified 680
149 Ga0451577_0428672 3300042876 Bacteria 1201
150 Ga0453683_0269049 3300044673 Bacteria 1087
151 Ga0453683_0329942 3300044673 Bacteria 978
152 Ga0453684_0000474 3300044712 Bacteria 159252
153 Ga0453684_0023367 3300044712 Bacteria 9114
154 Ga0451576_0000061 3300045051 Bacteria 284306
155 Ga0451576_0340262 3300045051 Bacteria 1571
156 Ga0495661_0144204 3300046665 Bacteria 1292
157 Ga0501034_0406977 3300049571 Bacteria 1283
158 Ga0501207_096303 3300049654 Bacteria 588
159 Ga0501208_060915 3300049655 Bacteria 739
160 Ga0501217_275151 3300049661 Bacteria 549
161 Ga0501233_121966 3300049668 Bacteria 705
162 Ga0501250_046692 3300049680 Bacteria 653
163 Ga0501251_033274 3300049681 Bacteria 746
164 Ga0501253_203858 3300049683 Bacteria 523
165 Ga0501257_052265 3300049686 Bacteria 1020
166 Ga0501221_173410 3300049704 Bacteria 585
167 Ga0501245_027101 3300049708 Bacteria 928
168 Ga0501232_042819 3300049757 Bacteria 673
169 Ga0501266_106624 3300049763 Bacteria 503
170 Ga0501268_061891 3300049765 Bacteria 743
171 nmdc:mga0k408_110893_c2 3300050493 Bacteria 1015
172 Ga0500645_092470 3300053730 Bacteria 857
173 Ga0070669_101235449
174 JGI24740J21852_10042683
175 Ga0065712_10215903
176 Ga0070683_100189051
177 Ga0070670_100034120
178 Ga0070670_100084469
179 Ga0070670_100259146
180 Ga0070677_10368655
181 Ga0068869_100028450
182 Ga0068869_101054485
183 Ga0068869_101990886
184 Ga0070689_101214951
185 Ga0070689_101604492
186 Ga0070668_100026058
187 Ga0070669_100394404
188 Ga0070669_100526968
189 Ga0070669_100778154
190 Ga0070671_100157174
191 Ga0070671_101436527
192 Ga0070673_100894603
193 Ga0070673_100941744
194 Ga0070659_100033996
195 Ga0070667_100054456
196 Ga0070667_101631617
197 Ga0070711_101327014
198 Ga0070700_100294902
199 Ga0070700_100786759
200 Ga0070679_100170887
201 Ga0068853_100049510
202 Ga0068853_100345499
203 Ga0068853_100891107
204 Ga0070672_100443041
205 Ga0070664_101554639
206 Ga0068854_101146014
207 Ga0068854_101337163
208 Ga0068856_100421801
209 Ga0070702_101058960
210 Ga0068852_100136202
211 Ga0068852_100254253
212 Ga0068852_100633305
213 Ga0068852_102053366
214 Ga0068859_100067422
215 Ga0068859_101161936
216 Ga0068859_102492065
217 Ga0068864_100026175
218 Ga0068864_100299389
219 Ga0068861_100912625
220 Ga0068851_10000112
221 Ga0068851_10688166
222 Ga0068863_100005620
223 Ga0068863_100528015
224 Ga0068863_101288252
225 Ga0068863_101308996
226 Ga0068860_100121868
227 Ga0068862_100003779
228 Ga0068862_101692387
229 Ga0075366_10282811
230 Ga0068871_100887931
231 Ga0097620_100067425
232 Ga0097620_101162025
233 Ga0097620_102491943
234 Ga0105240_10657312
235 Ga0111539_10808244
236 Ga0105242_10077401
237 Ga0105242_10684433
238 Ga0105237_10020135
239 Ga0105249_10030312
240 Ga0105249_10111257
241 Ga0105249_11354511
242 Ga0105249_11690348
243 Ga0105239_10036577
244 Ga0157371_10053812
245 Ga0157371_10444381
246 Ga0157371_10450909
247 Ga0157371_10550908
248 Ga0157374_10364093
249 Ga0157374_10654697
250 Ga0157378_10090028
251 Ga0157378_10833102
252 Ga0157378_11440700
253 Ga0163162_11616371
254 Ga0157372_10247983
255 Ga0157372_10273116
256 Ga0157372_10699722
257 Ga0157372_12136727
258 Ga0157372_12549238
259 Ga0157375_11617160
260 Ga0157380_10559225
261 Ga0157377_11222713
262 Ga0157379_10639263
263 Ga0157379_11417697
264 Ga0157376_10617840
265 Ga0213876_10274529
266 Ga0207426_1000030
267 Ga0207656_10000113
268 Ga0207682_10073608
269 Ga0207671_11152506
270 Ga0207660_10441357
271 Ga0207657_10027751
272 Ga0207652_10483173
273 Ga0207681_10239015
274 Ga0207681_10314018
275 Ga0207681_10674530
276 Ga0207681_10736583
277 Ga0207681_11228504
278 Ga0207650_10535372
279 Ga0207650_10613030
280 Ga0207659_10063892
281 Ga0207644_10101945
282 Ga0207690_10040579
283 Ga0207670_11077471
284 Ga0207691_10392148
285 Ga0207691_10704370
286 Ga0207689_10069790
287 Ga0207661_10279077
288 Ga0207651_10037551
289 Ga0207712_10651500
290 Ga0207668_10081892
291 Ga0207640_10553504
292 Ga0207658_10305493
293 Ga0207677_10173116
294 Ga0207639_10076041
295 Ga0207639_10328546
296 Ga0207708_10106777
297 Ga0207702_10271784
298 Ga0207641_10000013
299 Ga0207641_10475078
300 Ga0207641_11463546
301 Ga0207648_11302017
302 Ga0207676_10034551
303 Ga0207676_10174285
304 Ga0207674_10035446
305 Ga0207674_10140593
306 Ga0207675_102089821
307 Ga0207698_11252302
308 Ga0207698_11574116
309 Ga0268265_10060000
310 Ga0268265_11401838
311 Ga0268264_10015087
312 Ga0265323_10216064
313 Ga0265322_10000391
314 Ga0307515_10002910
315 Ga0265331_10197313
316 Ga0265327_10066390
317 Ga0436365_0320654
318 Ga0436365_1719163
319 Ga0451800_1485929
320 Ga0451807_2090069
321 Ga0451577_0428672
322 Ga0453683_0269049
323 Ga0453683_0329942
324 Ga0453684_0000474
325 Ga0453684_0023367
326 Ga0451576_0000061
327 Ga0451576_0340262
328 Ga0495661_0144204
329 Ga0501034_0406977
330 Ga0501207_096303
331 Ga0501208_060915
332 Ga0501217_275151
333 Ga0501233_121966
334 Ga0501250_046692
335 Ga0501251_033274
336 Ga0501253_203858
337 Ga0501257_052265
338 Ga0501221_173410
339 Ga0501245_027101
340 Ga0501232_042819
341 Ga0501266_106624
342 Ga0501268_061891
343 nmdc:mga0k408_110893_c2
344 Ga0500645_092470

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13366

PDDEXK_3

PD-(D/E)XK nuclease superfamily

7

120

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bn2-assembly1.cif.gz_A-2 crystal structure of acetyl-coa acetyltransferase from elizabethkingia anophelis nuhp1 0.8577 91 125
3hjz-assembly1.cif.gz_A the structure of an aldolase from prochlorococcus marinus 0.8319 5 45
6arl-assembly1.cif.gz_A aspergillus fumigatus cytosolic thiolase: apo enzyme in complex with rubidium ions 0.8291 91 122
6aqp-assembly1.cif.gz_D aspergillus fumigatus cytosolic thiolase: acetylated enzyme in complex with coa and potassium ions 0.8261 89 123
6arr-assembly1.cif.gz_D aspergillus fumigatus cytosolic thiolase: apo enzyme in complex with cesium ions 0.8249 89 123
ID Description Score Start End Superfamily
af_A0A1D6FCW8_19_445_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.83 91 122 3.40.47.10
af_Q8IKW7_5_397_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8031 97 123 3.40.47.10
af_Q55DN6_8_385_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.7914 89 123 3.40.47.10
af_A4I1N8_89_389_3.40.50.10300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;CoaB-like 0.7559 75 124 3.40.50.10300
1ulqE02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.7553 91 123 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A7Y4T7D8-F1-model_v4 GxxExxY protein 0.9865 67 130
AF-A0A3C0PH09-F1-model_v4 GxxExxY protein 0.966 18 124
AF-A0A3D2IFU3-F1-model_v4 GxxExxY protein 0.9585 1 125
AF-A0A7Y5R6S3-F1-model_v4 GxxExxY protein 0.9582 4 130
AF-A0A521EKU5-F1-model_v4 GxxExxY protein 0.9536 1 122

Map