F259549

General Info

Members Datasets Scaffolds Average Seq Length
171 102 171 223

Family's Representative Sequence

Representative Sequence 3300049579|Ga0501043_0051942|Ga0501043_0051942_1047_1724
Length 225
Sequence MIELIQFPWSPFCIVTRRILEFSQARFKVTDLKLTGDRSLIWELTDQRYYKVPVVKDGKNVVFELDEETQIVAKYLDDRLGLGLFPRELEGVQSVIWRNIEHEIEGLGFKLNDVFYREFVKPADQLPFLRHKERRFGTGCIDQWRASRPQLLKQLETKLMPYEEMLAYQPFLLDERPRFVDFDLYGMLGNFLFSGHYQLPKAHNHLRAWHRRMQHITLSQVAKNQ

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
20 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
27 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
31 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
32 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
33 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
47 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
48 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
49 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
50 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
51 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
52 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
53 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
54 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
55 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
56 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
57 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
58 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
59 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
60 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
61 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
62 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
63 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
64 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
65 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
70 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
71 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
72 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
73 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
74 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
75 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
76 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
77 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
78 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
79 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
80 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
81 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
82 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
83 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
84 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
85 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
86 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
87 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
88 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
89 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
90 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
91 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
92 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
93 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
94 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
100 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
101 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
102 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 0
Rhizosphere 99.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10203289 3300005290 Unclassified 1094
2 Ga0070683_100515920 3300005329 Bacteria 1142
3 Ga0070690_100024160 3300005330 Bacteria 3737
4 Ga0070690_100118261 3300005330 Bacteria 1776
5 Ga0070690_100203216 3300005330 Bacteria 1380
6 Ga0070690_100228168 3300005330 Unclassified 1308
7 Ga0068869_100392678 3300005334 Unclassified 1139
8 Ga0068869_100510990 3300005334 Unclassified 1004
9 Ga0070666_10138364 3300005335 Bacteria 1695
10 Ga0070689_100002876 3300005340 Bacteria 11324
11 Ga0070689_100008365 3300005340 Bacteria 7286
12 Ga0070689_100030328 3300005340 Bacteria 4104
13 Ga0070689_100202517 3300005340 Bacteria 1621
14 Ga0070688_100137037 3300005365 Bacteria 1658
15 Ga0070708_100058818 3300005445 Bacteria 3426
16 Ga0070681_10636847 3300005458 Bacteria 981
17 Ga0070685_10278164 3300005466 Unclassified 1119
18 Ga0070684_100191069 3300005535 Bacteria 1863
19 Ga0070697_100542565 3300005536 Bacteria 1019
20 Ga0070697_100815104 3300005536 Unclassified 826
21 Ga0070697_100872437 3300005536 Bacteria 798
22 Ga0070686_100005864 3300005544 Bacteria 6807
23 Ga0070686_100167326 3300005544 Bacteria 1552
24 Ga0070686_100201503 3300005544 Bacteria 1427
25 Ga0070686_100312644 3300005544 Unclassified 1169
26 Ga0068855_100296002 3300005563 Bacteria 1793
27 Ga0068859_100012090 3300005617 Bacteria 8675
28 Ga0068859_100302317 3300005617 Bacteria 1693
29 Ga0068859_101153385 3300005617 Unclassified 853
30 Ga0068863_100082407 3300005841 Unclassified 3049
31 Ga0068863_100099727 3300005841 Bacteria 2760
32 Ga0068863_100412556 3300005841 Unclassified 1322
33 Ga0068858_100205117 3300005842 Unclassified 1865
34 Ga0068858_100420543 3300005842 Unclassified 1285
35 Ga0097621_100090865 3300006237 Bacteria 2555
36 Ga0097621_100263957 3300006237 Unclassified 1511
37 Ga0068871_100287987 3300006358 Unclassified 1439
38 Ga0097620_100012090 3300006931 Bacteria 8675
39 Ga0097620_100019225 3300006931 Bacteria 6862
40 Ga0097620_100271462 3300006931 Bacteria 1788
41 Ga0097620_100302297 3300006931 Bacteria 1693
42 Ga0097620_101153573 3300006931 Unclassified 853
43 Ga0105240_10066380 3300009093 Bacteria 4476
44 Ga0111539_10201145 3300009094 Unclassified 2323
45 Ga0111539_10273896 3300009094 Bacteria 1964
46 Ga0111539_10330466 3300009094 Bacteria 1774
47 Ga0111539_10334478 3300009094 Unclassified 1763
48 Ga0105245_10746214 3300009098 Unclassified 1014
49 Ga0105242_10103979 3300009176 Bacteria 2410
50 Ga0105239_10917406 3300010375 Unclassified 1005
51 Ga0157374_10233005 3300013296 Unclassified 1809
52 Ga0157374_10640032 3300013296 Unclassified 1075
53 Ga0163162_11569328 3300013306 Bacteria 750
54 Ga0157372_11343357 3300013307 Unclassified 824
55 Ga0157375_10000172 3300013308 Bacteria 60073
56 Ga0157375_10104421 3300013308 Bacteria 2922
57 Ga0163163_10000153 3300014325 Bacteria 71877
58 Ga0163163_10010306 3300014325 Bacteria 8401
59 Ga0163163_10041763 3300014325 Bacteria 4487
60 Ga0157380_11002319 3300014326 Bacteria 869
61 Ga0163161_10208670 3300017792 Bacteria 1508
62 Ga0207680_10161484 3300025903 Bacteria 1503
63 Ga0207695_10009511 3300025913 Bacteria 12019
64 Ga0207695_10280372 3300025913 Bacteria 1560
65 Ga0207663_10319123 3300025916 Unclassified 1167
66 Ga0207694_10160776 3300025924 Unclassified 1814
67 Ga0207670_10008720 3300025936 Bacteria 5741
68 Ga0207670_10029222 3300025936 Bacteria 3509
69 Ga0207689_10473022 3300025942 Unclassified 1049
70 Ga0207667_10279615 3300025949 Bacteria 1706
71 Ga0207703_10107920 3300026035 Bacteria 2370
72 Ga0207703_10240330 3300026035 Bacteria 1628
73 Ga0207708_10217065 3300026075 Bacteria 1531
74 Ga0207641_10078419 3300026088 Unclassified 2861
75 Ga0207641_10115161 3300026088 Bacteria 2390
76 Ga0207648_10840469 3300026089 Unclassified 856
77 Ga0207676_10074650 3300026095 Unclassified 2733
78 Ga0207674_10054430 3300026116 Bacteria 4073
79 Ga0265337_1000045 3300028556 Bacteria 54551
80 Ga0265337_1004860 3300028556 Bacteria 5486
81 Ga0265326_10010899 3300028558 Bacteria 2691
82 Ga0265334_10006839 3300028573 Bacteria 4899
83 Ga0265338_10006452 3300028800 Bacteria 14952
84 Ga0265338_10030738 3300028800 Bacteria 5281
85 Ga0265338_10132817 3300028800 Unclassified 1962
86 Ga0265338_10277428 3300028800 Bacteria 1226
87 Ga0265340_10154756 3300031247 Unclassified 1043
88 Ga0265316_10046746 3300031344 Bacteria 3427
89 Ga0265316_10124630 3300031344 Bacteria 1944
90 Ga0265314_10031192 3300031711 Bacteria 3938
91 Ga0307413_10301055 3300031824 Bacteria 1216
92 Ga0307406_10118680 3300031901 Bacteria 1835
93 Ga0373932_0091694 3300035112 Unclassified 976
94 Ga0373945_0070334 3300035116 Unclassified 1323
95 Ga0373954_0034426 3300035118 Bacteria 2346
96 Ga0373956_0020306 3300035119 Bacteria 2825
97 Ga0373943_0099942 3300035170 Bacteria 1516
98 Ga0373946_0065002 3300035171 Unclassified 1561
99 Ga0373927_0116593 3300035695 Unclassified 1741
100 Ga0373933_0561988 3300035724 Unclassified 749
101 Ga0373947_0059243 3300035725 Unclassified 2321
102 Ga0373937_0323354 3300036401 Bacteria 1459
103 Ga0373925_0016124 3300037068 Bacteria 5409
104 Ga0395905_0088568 3300037471 Bacteria 2901
105 Ga0451577_0000708 3300042876 Bacteria 52139
106 Ga0451577_0004700 3300042876 Bacteria 14332
107 Ga0451577_0125611 3300042876 Bacteria 2299
108 Ga0453684_0019383 3300044712 Bacteria 10359
109 Ga0453684_0055136 3300044712 Bacteria 5170
110 Ga0451576_0046705 3300045051 Bacteria 4559
111 Ga0451576_0124845 3300045051 Bacteria 2682
112 Ga0451576_0195024 3300045051 Bacteria 2115
113 Ga0451576_0219900 3300045051 Unclassified 1983
114 Ga0451576_0711954 3300045051 Bacteria 1055
115 Ga0451576_0861658 3300045051 Archaea 951
116 Ga0451576_0917660 3300045051 Unclassified 919
117 Ga0451576_1345424 3300045051 Unclassified 744
118 Ga0495592_0000437 3300046454 Bacteria 31326
119 Ga0495641_0035595 3300046461 Bacteria 2345
120 Ga0495662_0100059 3300046476 Bacteria 1418
121 Ga0495664_0061962 3300046477 Bacteria 2227
122 Ga0495618_0002995 3300046514 Bacteria 10675
123 Ga0495618_0009255 3300046514 Bacteria 5944
124 Ga0495618_0049788 3300046514 Bacteria 2646
125 Ga0495628_0000054 3300046516 Bacteria 90760
126 Ga0495628_0183229 3300046516 Bacteria 1583
127 Ga0495630_0000198 3300046517 Bacteria 47012
128 Ga0495630_0010251 3300046517 Bacteria 6761
129 Ga0495630_0038794 3300046517 Bacteria 3563
130 Ga0495630_0088326 3300046517 Bacteria 2341
131 Ga0495666_0002822 3300046526 Bacteria 8701
132 Ga0495666_0018277 3300046526 Bacteria 3490
133 Ga0495666_0117615 3300046526 Unclassified 1246
134 Ga0495652_0096767 3300046529 Bacteria 2403
135 Ga0495640_0015082 3300046533 Bacteria 5821
136 Ga0495586_0000106 3300046535 Bacteria 49541
137 Ga0495586_0002421 3300046535 Bacteria 10119
138 Ga0495586_0009227 3300046535 Bacteria 5246
139 Ga0495586_0024596 3300046535 Unclassified 3220
140 Ga0495586_0051741 3300046535 Bacteria 2223
141 Ga0495586_0172232 3300046535 Bacteria 1223
142 Ga0495645_0083611 3300046543 Bacteria 2288
143 Ga0495622_0011270 3300046557 Bacteria 4128
144 Ga0495634_0202467 3300046642 Unclassified 1232
145 Ga0495599_0015151 3300046678 Bacteria 4781
146 Ga0495599_0156155 3300046678 Bacteria 1412
147 Ga0495646_0207162 3300046680 Unclassified 1065
148 Ga0495647_0022876 3300046681 Bacteria 2262
149 Ga0495658_0081822 3300046683 Bacteria 1897
150 Ga0495613_0001832 3300046689 Bacteria 16160
151 Ga0495613_0006170 3300046689 Bacteria 8975
152 Ga0495613_0303066 3300046689 Bacteria 1106
153 Ga0495624_0029246 3300046690 Bacteria 3596
154 Ga0495674_0003039 3300047319 Bacteria 16327
155 Ga0495674_0021244 3300047319 Bacteria 6005
156 Ga0495676_0023543 3300047321 Bacteria 5344
157 Ga0495676_0046075 3300047321 Bacteria 3544
158 Ga0495680_0082367 3300047322 Bacteria 2428
159 Ga0495680_0159162 3300047322 Bacteria 1641
160 Ga0495675_0044230 3300047444 Bacteria 2837
161 Ga0501031_0006152 3300049568 Bacteria 7835
162 Ga0501032_0028303 3300049569 Bacteria 3851
163 Ga0501033_0035507 3300049570 Bacteria 3738
164 Ga0501043_0051942 3300049579 Bacteria 3221
165 Ga0501035_0070685 3300049822 Bacteria 3091
166 Ga0501044_0005027 3300049823 Bacteria 14763
167 Ga0501044_0087062 3300049823 Bacteria 3155
168 nmdc:mga08y16_230528_c1 3300050511 Unclassified 1915
169 nmdc:mga08y16_328207_c1 3300050511 Bacteria 1574
170 Ga0495601_0073131 3300053077 Bacteria 2191
171 Ga0500650_0042739 3300053098 Bacteria 2095

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0019383 Ga0453684_0019383_5503_6195 199
2 3300044712 Ga0453684_0055136 Ga0453684_0055136_3545_4210 200
3 3300037471 Ga0395905_0088568 Ga0395905_0088568_798_1418 206
4 3300049568 Ga0501031_0006152 Ga0501031_0006152_5659_6318 207
5 3300049569 Ga0501032_0028303 Ga0501032_0028303_3140_3799 207
6 3300049570 Ga0501033_0035507 Ga0501033_0035507_2265_2924 207
7 3300049822 Ga0501035_0070685 Ga0501035_0070685_2320_2979 207
8 3300049823 Ga0501044_0005027 Ga0501044_0005027_6804_7463 207
9 3300031247 Ga0265340_10154756 Ga0265340_101547562 209
10 3300046526 Ga0495666_0117615 Ga0495666_0117615_582_1232 214
11 3300005617 Ga0068859_100302317 Ga0068859_1003023171 215
12 3300006931 Ga0097620_100302297 Ga0097620_1003022973 215
13 3300014325 Ga0163163_10000153 Ga0163163_1000015350 215
14 3300026116 Ga0207674_10054430 Ga0207674_100544305 216
15 3300035118 Ga0373954_0034426 Ga0373954_0034426_733_1386 217
16 3300035119 Ga0373956_0020306 Ga0373956_0020306_2093_2746 217
17 3300035170 Ga0373943_0099942 Ga0373943_0099942_698_1390 217
18 3300036401 Ga0373937_0323354 Ga0373937_0323354_230_883 217
19 3300045051 Ga0451576_0046705 Ga0451576_0046705_2092_2778 217
20 3300046514 Ga0495618_0009255 Ga0495618_0009255_635_1288 217
21 3300046517 Ga0495630_0088326 Ga0495630_0088326_747_1400 217
22 3300046535 Ga0495586_0024596 Ga0495586_0024596_1165_1818 217
23 3300046642 Ga0495634_0202467 Ga0495634_0202467_364_1017 217
24 3300046681 Ga0495647_0022876 Ga0495647_0022876_1246_1899 217
25 3300046689 Ga0495613_0001832 Ga0495613_0001832_5508_6161 217
26 3300047322 Ga0495680_0082367 Ga0495680_0082367_525_1178 217
27 3300045051 Ga0451576_1345424 Ga0451576_1345424_76_732 218
28 3300005330 Ga0070690_100024160 Ga0070690_1000241605 219
29 3300005535 Ga0070684_100191069 Ga0070684_1001910692 219
30 3300005544 Ga0070686_100167326 Ga0070686_1001673262 219
31 3300005563 Ga0068855_100296002 Ga0068855_1002960021 219
32 3300025949 Ga0207667_10279615 Ga0207667_102796153 219
33 3300031824 Ga0307413_10301055 Ga0307413_103010551 219
34 3300031901 Ga0307406_10118680 Ga0307406_101186802 219
35 3300045051 Ga0451576_0861658 Ga0451576_0861658_252_911 219
36 3300046557 Ga0495622_0011270 Ga0495622_0011270_89_748 219
37 3300049823 Ga0501044_0087062 Ga0501044_0087062_139_798 219
38 3300005544 Ga0070686_100005864 Ga0070686_1000058646 220
39 3300005617 Ga0068859_100012090 Ga0068859_1000120907 220
40 3300005842 Ga0068858_100205117 Ga0068858_1002051172 220
41 3300006931 Ga0097620_100012090 Ga0097620_1000120905 220
42 3300013307 Ga0157372_11343357 Ga0157372_113433571 220
43 3300014326 Ga0157380_11002319 Ga0157380_110023191 220
44 3300026035 Ga0207703_10240330 Ga0207703_102403303 220
45 3300035724 Ga0373933_0561988 Ga0373933_0561988_20_682 220
46 3300046535 Ga0495586_0051741 Ga0495586_0051741_1200_1862 220
47 3300005330 Ga0070690_100203216 Ga0070690_1002032162 221
48 3300005334 Ga0068869_100510990 Ga0068869_1005109901 221
49 3300005340 Ga0070689_100002876 Ga0070689_1000028765 221
50 3300005340 Ga0070689_100202517 Ga0070689_1002025171 221
51 3300005445 Ga0070708_100058818 Ga0070708_1000588182 221
52 3300005536 Ga0070697_100872437 Ga0070697_1008724371 221
53 3300005544 Ga0070686_100201503 Ga0070686_1002015032 221
54 3300005841 Ga0068863_100099727 Ga0068863_1000997272 221
55 3300006237 Ga0097621_100090865 Ga0097621_1000908653 221
56 3300006358 Ga0068871_100287987 Ga0068871_1002879872 221
57 3300009094 Ga0111539_10273896 Ga0111539_102738962 221
58 3300009098 Ga0105245_10746214 Ga0105245_107462141 221
59 3300010375 Ga0105239_10917406 Ga0105239_109174061 221
60 3300025936 Ga0207670_10008720 Ga0207670_100087202 221
61 3300025942 Ga0207689_10473022 Ga0207689_104730221 221
62 3300026088 Ga0207641_10115161 Ga0207641_101151612 221
63 3300028558 Ga0265326_10010899 Ga0265326_100108992 221
64 3300028573 Ga0265334_10006839 Ga0265334_100068392 221
65 3300028800 Ga0265338_10030738 Ga0265338_100307384 221
66 3300028800 Ga0265338_10132817 Ga0265338_101328172 221
67 3300028800 Ga0265338_10277428 Ga0265338_102774281 221
68 3300031344 Ga0265316_10046746 Ga0265316_100467462 221
69 3300031344 Ga0265316_10124630 Ga0265316_101246301 221
70 3300031711 Ga0265314_10031192 Ga0265314_100311923 221
71 3300050511 nmdc:mga08y16_328207_c1 nmdc:mga08y16_328207_c1_684_1349 221
72 3300005330 Ga0070690_100118261 Ga0070690_1001182612 222
73 3300005335 Ga0070666_10138364 Ga0070666_101383641 222
74 3300013306 Ga0163162_11569328 Ga0163162_115693281 222
75 3300013308 Ga0157375_10000172 Ga0157375_1000017213 222
76 3300025903 Ga0207680_10161484 Ga0207680_101614842 222
77 3300028556 Ga0265337_1000045 Ga0265337_10000457 222
78 3300028800 Ga0265338_10006452 Ga0265338_1000645210 222
79 3300042876 Ga0451577_0004700 Ga0451577_0004700_5748_6419 222
80 3300046535 Ga0495586_0172232 Ga0495586_0172232_432_1100 222
81 3300047322 Ga0495680_0159162 Ga0495680_0159162_937_1605 222
82 3300053098 Ga0500650_0042739 Ga0500650_0042739_1279_1947 222
83 3300009093 Ga0105240_10066380 Ga0105240_100663807 224
84 3300025913 Ga0207695_10280372 Ga0207695_102803722 224
85 3300045051 Ga0451576_0124845 Ga0451576_0124845_1484_2161 224
86 3300049579 Ga0501043_0051942 Ga0501043_0051942_1047_1724 224
87 3300005340 Ga0070689_100030328 Ga0070689_1000303284 226
88 3300005330 Ga0070690_100228168 Ga0070690_1002281682 227
89 3300005340 Ga0070689_100008365 Ga0070689_1000083656 227
90 3300005458 Ga0070681_10636847 Ga0070681_106368472 227
91 3300005544 Ga0070686_100312644 Ga0070686_1003126442 227
92 3300006931 Ga0097620_100019225 Ga0097620_1000192255 227
93 3300006931 Ga0097620_100271462 Ga0097620_1002714622 227
94 3300009094 Ga0111539_10201145 Ga0111539_102011452 227
95 3300009094 Ga0111539_10330466 Ga0111539_103304663 227
96 3300014325 Ga0163163_10010306 Ga0163163_100103065 227
97 3300025924 Ga0207694_10160776 Ga0207694_101607762 227
98 3300025936 Ga0207670_10029222 Ga0207670_100292223 227
99 3300026075 Ga0207708_10217065 Ga0207708_102170651 227
100 3300026089 Ga0207648_10840469 Ga0207648_108404692 227
101 3300045051 Ga0451576_0917660 Ga0451576_0917660_145_828 227
102 3300046454 Ga0495592_0000437 Ga0495592_0000437_9535_10218 227
103 3300046477 Ga0495664_0061962 Ga0495664_0061962_386_1069 227
104 3300046514 Ga0495618_0002995 Ga0495618_0002995_8518_9201 227
105 3300046516 Ga0495628_0000054 Ga0495628_0000054_69132_69815 227
106 3300046517 Ga0495630_0010251 Ga0495630_0010251_1806_2489 227
107 3300046526 Ga0495666_0018277 Ga0495666_0018277_1711_2394 227
108 3300046529 Ga0495652_0096767 Ga0495652_0096767_1004_1687 227
109 3300046533 Ga0495640_0015082 Ga0495640_0015082_2046_2729 227
110 3300046535 Ga0495586_0009227 Ga0495586_0009227_294_977 227
111 3300046543 Ga0495645_0083611 Ga0495645_0083611_228_920 227
112 3300046678 Ga0495599_0015151 Ga0495599_0015151_3120_3803 227
113 3300046680 Ga0495646_0207162 Ga0495646_0207162_318_1001 227
114 3300046683 Ga0495658_0081822 Ga0495658_0081822_916_1599 227
115 3300046690 Ga0495624_0029246 Ga0495624_0029246_2861_3544 227
116 3300047319 Ga0495674_0021244 Ga0495674_0021244_2127_2810 227
117 3300005290 Ga0065712_10203289 Ga0065712_102032892 228
118 3300005329 Ga0070683_100515920 Ga0070683_1005159202 228
119 3300005334 Ga0068869_100392678 Ga0068869_1003926781 228
120 3300005365 Ga0070688_100137037 Ga0070688_1001370372 228
121 3300005466 Ga0070685_10278164 Ga0070685_102781642 228
122 3300005536 Ga0070697_100542565 Ga0070697_1005425651 228
123 3300005536 Ga0070697_100815104 Ga0070697_1008151041 228
124 3300005617 Ga0068859_101153385 Ga0068859_1011533851 228
125 3300005841 Ga0068863_100082407 Ga0068863_1000824072 228
126 3300005841 Ga0068863_100412556 Ga0068863_1004125562 228
127 3300005842 Ga0068858_100420543 Ga0068858_1004205432 228
128 3300006237 Ga0097621_100263957 Ga0097621_1002639572 228
129 3300006931 Ga0097620_101153573 Ga0097620_1011535731 228
130 3300009094 Ga0111539_10334478 Ga0111539_103344782 228
131 3300009176 Ga0105242_10103979 Ga0105242_101039792 228
132 3300013296 Ga0157374_10233005 Ga0157374_102330051 228
133 3300013296 Ga0157374_10640032 Ga0157374_106400322 228
134 3300013308 Ga0157375_10104421 Ga0157375_101044213 228
135 3300014325 Ga0163163_10041763 Ga0163163_100417635 228
136 3300017792 Ga0163161_10208670 Ga0163161_102086702 228
137 3300025913 Ga0207695_10009511 Ga0207695_100095119 228
138 3300025916 Ga0207663_10319123 Ga0207663_103191232 228
139 3300026035 Ga0207703_10107920 Ga0207703_101079202 228
140 3300026088 Ga0207641_10078419 Ga0207641_100784193 228
141 3300026095 Ga0207676_10074650 Ga0207676_100746502 228
142 3300028556 Ga0265337_1004860 Ga0265337_10048603 228
143 3300035112 Ga0373932_0091694 Ga0373932_0091694_120_806 228
144 3300035116 Ga0373945_0070334 Ga0373945_0070334_144_836 228
145 3300035171 Ga0373946_0065002 Ga0373946_0065002_162_854 228
146 3300035695 Ga0373927_0116593 Ga0373927_0116593_199_891 228
147 3300035725 Ga0373947_0059243 Ga0373947_0059243_433_1125 228
148 3300037068 Ga0373925_0016124 Ga0373925_0016124_2559_3251 228
149 3300042876 Ga0451577_0000708 Ga0451577_0000708_9550_10287 228
150 3300042876 Ga0451577_0125611 Ga0451577_0125611_920_1606 228
151 3300045051 Ga0451576_0195024 Ga0451576_0195024_563_1270 228
152 3300045051 Ga0451576_0219900 Ga0451576_0219900_372_1058 228
153 3300045051 Ga0451576_0711954 Ga0451576_0711954_197_883 228
154 3300046461 Ga0495641_0035595 Ga0495641_0035595_380_1066 228
155 3300046476 Ga0495662_0100059 Ga0495662_0100059_78_764 228
156 3300046514 Ga0495618_0049788 Ga0495618_0049788_1700_2386 228
157 3300046516 Ga0495628_0183229 Ga0495628_0183229_151_837 228
158 3300046517 Ga0495630_0000198 Ga0495630_0000198_13379_14065 228
159 3300046517 Ga0495630_0038794 Ga0495630_0038794_1611_2303 228
160 3300046526 Ga0495666_0002822 Ga0495666_0002822_3650_4336 228
161 3300046535 Ga0495586_0000106 Ga0495586_0000106_35497_36183 228
162 3300046535 Ga0495586_0002421 Ga0495586_0002421_1202_1888 228
163 3300046678 Ga0495599_0156155 Ga0495599_0156155_338_1024 228
164 3300046689 Ga0495613_0006170 Ga0495613_0006170_6416_7102 228
165 3300046689 Ga0495613_0303066 Ga0495613_0303066_293_979 228
166 3300047319 Ga0495674_0003039 Ga0495674_0003039_2289_2975 228
167 3300047321 Ga0495676_0023543 Ga0495676_0023543_1992_2678 228
168 3300047321 Ga0495676_0046075 Ga0495676_0046075_1503_2189 228
169 3300047444 Ga0495675_0044230 Ga0495675_0044230_1039_1725 228
170 3300050511 nmdc:mga08y16_230528_c1 nmdc:mga08y16_230528_c1_358_1044 228
171 3300053077 Ga0495601_0073131 Ga0495601_0073131_1456_2142 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

142

212

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lyk-assembly1.cif.gz_A structure of stringent starvation protein a homolog from haemophilus influenzae 0.8437 1 214
3mdk-assembly1.cif.gz_A structure of stringent starvation protein a (sspa) from pseudomonas putida 0.8402 1 211
4g19-assembly2.cif.gz_D crystal structure of the glutathione transferase gte1 from phanerochaete chrysosporium in complex with glutathione 0.8391 2 219
4lmw-assembly1.cif.gz_A-2 crystal structure of glutathione transferase gstfua3 from phanerochaete chrysosporium 0.8193 2 220
1yy7-assembly1.cif.gz_B crystal structure of stringent starvation protein a (sspa), an rna polymerase-associated transcription factor 0.8189 1 214
ID Description Score Start End Superfamily
af_P0ACA3_4_88_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8992 1 80 3.40.30.10
5g5fA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8906 2 80 3.40.30.10
af_B6U5S1_5_83_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8832 1 80 3.40.30.10
4ielA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8802 1 79 3.40.30.10
6mhcA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8759 2 78 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A832HWG5-F1-model_v4 Glutathione S-transferase family protein 0.9962 1 196 GO:0016740
AF-A0A6N6PQ05-F1-model_v4 Glutathione S-transferase family protein 0.9956 1 216 GO:0016740
AF-A0A832HWG5-F1-model_v4 Glutathione S-transferase family protein 0.9911 1 196 GO:0016740
AF-A0A2V2SAR8-F1-model_v4 GST N-terminal domain-containing protein 0.9888 1 224
AF-A0A521SAY4-F1-model_v4 GST N-terminal domain-containing protein 0.9717 3 149

Feature Viewer

pLDDT pTM Quality
92.99 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map