F259407
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 171 | 132 | 171 | 377 |
Family's Representative Sequence
| Representative Sequence | 3300046691|Ga0495670_0033773|Ga0495670_0033773_1434_2495 |
| Length | 344 |
| Sequence | VRPDALARLAEQSALMGTSHRQKPVRDLVARVRGGLADLFSLPDGYEIVLGNGGTTAFWDAAAAWLVRERALHLSYGEFSQKFAKVTAAAPFLADSILVEADPGDAPAPVWAHNETSTGVMVAVARPEGAGEALVLVDATSGAGGLPLDASQADAYYFAPQKAFGADGGLWLAALSPAAIARIEQLDGAADRWQPAFLSLQTALENSRKEQTYNTPALATLLLLADQVEWMLAGGGLNWCVERTSASSGHLYGWAERTDFASPFVADPAKRSLVVGTIDFDDSVDAAAVAATLRANGIVDVEPYRKLGRNQLRIGMFPSVEPADVEALTACIDWVVENVGEARS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 2 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 3 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 4 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 11 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 15 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 16 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 17 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 18 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 19 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 21 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 22 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 23 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 28 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 54 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 55 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 56 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 57 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 58 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 59 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 60 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 61 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 62 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 63 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 64 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 65 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 66 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 67 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 68 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 69 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 70 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 71 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 72 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 73 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 74 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 107 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 108 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 109 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 110 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 111 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 112 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 113 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 114 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 115 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 116 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 117 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 118 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 119 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 120 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 121 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 123 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 124 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 125 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 126 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 127 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.51 |
| Nodule | 0 |
| Rhizoplane | 12.28 |
| Rhizosphere | 82.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24034J26672_10000377 | 3300002239 | Bacteria | 5789 |
| 2 | Ga0068868_100000633 | 3300005338 | Bacteria | 23661 |
| 3 | Ga0070691_10009524 | 3300005341 | Bacteria | 4435 |
| 4 | Ga0070691_10027617 | 3300005341 | Bacteria | 2649 |
| 5 | Ga0070674_100000004 | 3300005356 | Bacteria | 169446 |
| 6 | Ga0070673_100000474 | 3300005364 | Bacteria | 21373 |
| 7 | Ga0070714_100186178 | 3300005435 | Bacteria | 1892 |
| 8 | Ga0070663_100125718 | 3300005455 | Bacteria | 1942 |
| 9 | Ga0070662_100000006 | 3300005457 | Bacteria | 169366 |
| 10 | Ga0070681_10003891 | 3300005458 | Bacteria | 14065 |
| 11 | Ga0068867_100002668 | 3300005459 | Bacteria | 12591 |
| 12 | Ga0070679_100000844 | 3300005530 | Bacteria | 26718 |
| 13 | Ga0070665_100000040 | 3300005548 | Bacteria | 305480 |
| 14 | Ga0070664_100038179 | 3300005564 | Bacteria | 4042 |
| 15 | Ga0068866_10000004 | 3300005718 | Bacteria | 202810 |
| 16 | Ga0068858_100001009 | 3300005842 | Bacteria | 29022 |
| 17 | Ga0068860_100118890 | 3300005843 | Bacteria | 2530 |
| 18 | Ga0075365_10030559 | 3300006038 | Bacteria | 3451 |
| 19 | Ga0075365_10092060 | 3300006038 | Bacteria | 2067 |
| 20 | Ga0075364_10054857 | 3300006051 | Bacteria | 2607 |
| 21 | Ga0070715_10000014 | 3300006163 | Bacteria | 154272 |
| 22 | Ga0097621_100116678 | 3300006237 | Bacteria | 2261 |
| 23 | Ga0068871_100340113 | 3300006358 | Bacteria | 1325 |
| 24 | Ga0075433_10000244 | 3300006852 | Bacteria | 31446 |
| 25 | Ga0105240_10337301 | 3300009093 | Bacteria | 1713 |
| 26 | Ga0105245_10071389 | 3300009098 | Bacteria | 3153 |
| 27 | Ga0105238_10000048 | 3300009551 | Bacteria | 146322 |
| 28 | Ga0105249_10059376 | 3300009553 | Bacteria | 3507 |
| 29 | Ga0157374_10001900 | 3300013296 | Bacteria | 17502 |
| 30 | Ga0157375_10008154 | 3300013308 | Bacteria | 9167 |
| 31 | Ga0157380_10000507 | 3300014326 | Bacteria | 23819 |
| 32 | Ga0157379_10014841 | 3300014968 | Bacteria | 6832 |
| 33 | Ga0163161_10000160 | 3300017792 | Bacteria | 62228 |
| 34 | Ga0207682_10000140 | 3300025893 | Bacteria | 32624 |
| 35 | Ga0207642_10000005 | 3300025899 | Bacteria | 401934 |
| 36 | Ga0207685_10000025 | 3300025905 | Bacteria | 110358 |
| 37 | Ga0207695_10254870 | 3300025913 | Bacteria | 1653 |
| 38 | Ga0207663_10000748 | 3300025916 | Bacteria | 14481 |
| 39 | Ga0207694_10000056 | 3300025924 | Bacteria | 146908 |
| 40 | Ga0207687_10000020 | 3300025927 | Bacteria | 228407 |
| 41 | Ga0207687_10001900 | 3300025927 | Bacteria | 14372 |
| 42 | Ga0207706_10000017 | 3300025933 | Bacteria | 169589 |
| 43 | Ga0207686_10000199 | 3300025934 | Bacteria | 46373 |
| 44 | Ga0207670_10056756 | 3300025936 | Bacteria | 2653 |
| 45 | Ga0207669_10000131 | 3300025937 | Bacteria | 37319 |
| 46 | Ga0207661_10067537 | 3300025944 | Bacteria | 2908 |
| 47 | Ga0207679_10020749 | 3300025945 | Bacteria | 4440 |
| 48 | Ga0207651_10000664 | 3300025960 | Bacteria | 14678 |
| 49 | Ga0207677_10001178 | 3300026023 | Bacteria | 14220 |
| 50 | Ga0207703_10000166 | 3300026035 | Bacteria | 76553 |
| 51 | Ga0207639_10210063 | 3300026041 | Bacteria | 1675 |
| 52 | Ga0207678_10105781 | 3300026067 | Bacteria | 2401 |
| 53 | Ga0207702_10004436 | 3300026078 | Bacteria | 12465 |
| 54 | Ga0207648_10001799 | 3300026089 | Bacteria | 23490 |
| 55 | Ga0268266_10000045 | 3300028379 | Bacteria | 312955 |
| 56 | Ga0265337_1000805 | 3300028556 | Bacteria | 16508 |
| 57 | Ga0265326_10000084 | 3300028558 | Bacteria | 50129 |
| 58 | Ga0265322_10000198 | 3300028654 | Bacteria | 26588 |
| 59 | Ga0265324_10023816 | 3300029957 | Bacteria | 2178 |
| 60 | Ga0265332_10037936 | 3300031238 | Bacteria | 2089 |
| 61 | Ga0265328_10017656 | 3300031239 | Bacteria | 2761 |
| 62 | Ga0265320_10000035 | 3300031240 | Bacteria | 137855 |
| 63 | Ga0265329_10019214 | 3300031242 | Bacteria | 2323 |
| 64 | Ga0265331_10023158 | 3300031250 | Bacteria | 3160 |
| 65 | Ga0265327_10000015 | 3300031251 | Bacteria | 496677 |
| 66 | Ga0265316_10027343 | 3300031344 | Bacteria | 4725 |
| 67 | Ga0265313_10109429 | 3300031595 | Bacteria | 1216 |
| 68 | Ga0265314_10000690 | 3300031711 | Bacteria | 40955 |
| 69 | Ga0265342_10118561 | 3300031712 | Bacteria | 1492 |
| 70 | Ga0373955_0028899 | 3300035172 | Bacteria | 2879 |
| 71 | Ga0373937_0007200 | 3300036401 | Bacteria | 9627 |
| 72 | Ga0373937_0285134 | 3300036401 | Bacteria | 1560 |
| 73 | Ga0451853_1338654 | 3300041512 | Bacteria | 1858 |
| 74 | Ga0466963_0000022 | 3300044694 | Bacteria | 52600 |
| 75 | Ga0466963_0066096 | 3300044694 | Bacteria | 2425 |
| 76 | Ga0466963_0106532 | 3300044694 | Bacteria | 1922 |
| 77 | Ga0466971_0012532 | 3300044719 | Bacteria | 3718 |
| 78 | Ga0466960_0000033 | 3300044901 | Bacteria | 46153 |
| 79 | Ga0466960_0057097 | 3300044901 | Bacteria | 1902 |
| 80 | Ga0466967_0326441 | 3300045976 | Bacteria | 1481 |
| 81 | Ga0495592_0000912 | 3300046454 | Bacteria | 20489 |
| 82 | Ga0495629_0022340 | 3300046459 | Bacteria | 4511 |
| 83 | Ga0495638_0093251 | 3300046460 | Bacteria | 1811 |
| 84 | Ga0495651_0138823 | 3300046462 | Bacteria | 1765 |
| 85 | Ga0495653_0033150 | 3300046463 | Bacteria | 4094 |
| 86 | Ga0495650_0000398 | 3300046471 | Bacteria | 72672 |
| 87 | Ga0495582_0000001 | 3300046473 | Bacteria | 252434 |
| 88 | Ga0495662_0000133 | 3300046476 | Bacteria | 28271 |
| 89 | Ga0495594_0125555 | 3300046499 | Bacteria | 1452 |
| 90 | Ga0495608_0003019 | 3300046511 | Bacteria | 12014 |
| 91 | Ga0495608_0037719 | 3300046511 | Bacteria | 3249 |
| 92 | Ga0495620_0002158 | 3300046515 | Bacteria | 11431 |
| 93 | Ga0495628_0022200 | 3300046516 | Bacteria | 5216 |
| 94 | Ga0495628_0078105 | 3300046516 | Bacteria | 2574 |
| 95 | Ga0495628_0154434 | 3300046516 | Bacteria | 1747 |
| 96 | Ga0495630_0000012 | 3300046517 | Bacteria | 223330 |
| 97 | Ga0495630_0003163 | 3300046517 | Bacteria | 11429 |
| 98 | Ga0495630_0064844 | 3300046517 | Bacteria | 2745 |
| 99 | Ga0495652_0004585 | 3300046529 | Bacteria | 13174 |
| 100 | Ga0495640_0007812 | 3300046533 | Bacteria | 8414 |
| 101 | Ga0495587_0074999 | 3300046536 | Bacteria | 1964 |
| 102 | Ga0495621_0001449 | 3300046539 | Bacteria | 6146 |
| 103 | Ga0495645_0032740 | 3300046543 | Bacteria | 3792 |
| 104 | Ga0495645_0073531 | 3300046543 | Bacteria | 2462 |
| 105 | Ga0495645_0103932 | 3300046543 | Bacteria | 2018 |
| 106 | Ga0495656_0000295 | 3300046615 | Bacteria | 17274 |
| 107 | Ga0495634_0010503 | 3300046642 | Bacteria | 6783 |
| 108 | Ga0495657_0006985 | 3300046675 | Bacteria | 8756 |
| 109 | Ga0495657_0155255 | 3300046675 | Bacteria | 1419 |
| 110 | Ga0495647_0000043 | 3300046681 | Bacteria | 36874 |
| 111 | Ga0495658_0000193 | 3300046683 | Bacteria | 35142 |
| 112 | Ga0495669_0000102 | 3300046684 | Bacteria | 53777 |
| 113 | Ga0495613_0000282 | 3300046689 | Bacteria | 47001 |
| 114 | Ga0495613_0030444 | 3300046689 | Bacteria | 4009 |
| 115 | Ga0495613_0074173 | 3300046689 | Bacteria | 2478 |
| 116 | Ga0495613_0111304 | 3300046689 | Bacteria | 1972 |
| 117 | Ga0495613_0162278 | 3300046689 | Bacteria | 1589 |
| 118 | Ga0495624_0006535 | 3300046690 | Bacteria | 8263 |
| 119 | Ga0495670_0033773 | 3300046691 | Bacteria | 2546 |
| 120 | Ga0495600_0001288 | 3300046809 | Bacteria | 13857 |
| 121 | Ga0495600_0299081 | 3300046809 | Bacteria | 1015 |
| 122 | Ga0495604_0000267 | 3300047317 | Bacteria | 46398 |
| 123 | Ga0495604_0028724 | 3300047317 | Bacteria | 4425 |
| 124 | Ga0495676_0001626 | 3300047321 | Bacteria | 19533 |
| 125 | Ga0495676_0010974 | 3300047321 | Bacteria | 8192 |
| 126 | Ga0495676_0018201 | 3300047321 | Bacteria | 6197 |
| 127 | Ga0495680_0000193 | 3300047322 | Bacteria | 65567 |
| 128 | Ga0495680_0005500 | 3300047322 | Bacteria | 11903 |
| 129 | Ga0495679_023349 | 3300047446 | Bacteria | 2099 |
| 130 | Ga0496100_0000005 | 3300048903 | Bacteria | 312112 |
| 131 | Ga0496100_0000014 | 3300048903 | Bacteria | 174991 |
| 132 | Ga0496101_0000036 | 3300048904 | Bacteria | 175595 |
| 133 | Ga0496101_0000493 | 3300048904 | Bacteria | 24897 |
| 134 | Ga0496104_0000024 | 3300048907 | Bacteria | 229913 |
| 135 | Ga0496105_0000013 | 3300048908 | Bacteria | 229894 |
| 136 | Ga0496106_0000043 | 3300048909 | Bacteria | 105477 |
| 137 | Ga0496106_0000193 | 3300048909 | Bacteria | 42951 |
| 138 | Ga0496106_0001892 | 3300048909 | Bacteria | 15675 |
| 139 | Ga0496107_0000094 | 3300048910 | Bacteria | 42797 |
| 140 | Ga0496107_0000271 | 3300048910 | Bacteria | 27463 |
| 141 | Ga0496108_0001109 | 3300048911 | Bacteria | 21079 |
| 142 | Ga0496108_0051885 | 3300048911 | Bacteria | 3436 |
| 143 | Ga0496109_0000004 | 3300048912 | Bacteria | 404818 |
| 144 | Ga0496109_0001414 | 3300048912 | Bacteria | 19912 |
| 145 | Ga0496110_0185063 | 3300048913 | Bacteria | 1891 |
| 146 | Ga0496113_0099741 | 3300048916 | Bacteria | 2249 |
| 147 | Ga0496113_0245217 | 3300048916 | Bacteria | 1430 |
| 148 | Ga0496114_0018100 | 3300048917 | Bacteria | 5693 |
| 149 | Ga0496115_0000010 | 3300048918 | Bacteria | 227112 |
| 150 | Ga0496115_0001569 | 3300048918 | Bacteria | 16428 |
| 151 | Ga0496119_0000055 | 3300048922 | Bacteria | 180121 |
| 152 | Ga0496125_0052525 | 3300048928 | Bacteria | 3351 |
| 153 | Ga0501034_0019495 | 3300049571 | Bacteria | 6937 |
| 154 | Ga0501034_0228135 | 3300049571 | Bacteria | 1812 |
| 155 | Ga0501047_0046520 | 3300049581 | Bacteria | 4194 |
| 156 | Ga0501075_0003224 | 3300049591 | Bacteria | 10913 |
| 157 | Ga0501081_0066390 | 3300049743 | Bacteria | 2509 |
| 158 | Ga0501044_0015577 | 3300049823 | Bacteria | 8192 |
| 159 | nmdc:mga0yw44_33607_c1 | 3300050492 | Bacteria | 2998 |
| 160 | nmdc:mga0yw44_94602_c1 | 3300050492 | Bacteria | 1894 |
| 161 | nmdc:mga0a205_45_c1 | 3300050515 | Bacteria | 68070 |
| 162 | Ga0495601_0000156 | 3300053077 | Bacteria | 38350 |
| 163 | Ga0495612_0003529 | 3300053078 | Bacteria | 6484 |
| 164 | Ga0495655_0000023 | 3300053083 | Bacteria | 39507 |
| 165 | Ga0495595_0000200 | 3300053084 | Bacteria | 24133 |
| 166 | Ga0495595_0023189 | 3300053084 | Bacteria | 2730 |
| 167 | Ga0495619_0000602 | 3300053085 | Bacteria | 23838 |
| 168 | Ga0495619_0002992 | 3300053085 | Bacteria | 10976 |
| 169 | Ga0495619_0003076 | 3300053085 | Bacteria | 10833 |
| 170 | Ga0495619_0025796 | 3300053085 | Bacteria | 3777 |
| 171 | Ga0500628_000001 | 3300053129 | Bacteria | 564074 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046809 | Ga0495600_0299081 | Ga0495600_0299081_11_991 | 326 |
| 2 | 3300053084 | Ga0495595_0023189 | Ga0495595_0023189_1699_2700 | 332 |
| 3 | 3300046516 | Ga0495628_0154434 | Ga0495628_0154434_16_1032 | 338 |
| 4 | 3300046691 | Ga0495670_0033773 | Ga0495670_0033773_1434_2495 | 344 |
| 5 | 3300045976 | Ga0466967_0326441 | Ga0466967_0326441_114_1169 | 351 |
| 6 | 3300047446 | Ga0495679_023349 | Ga0495679_023349_61_1122 | 353 |
| 7 | 3300048913 | Ga0496110_0185063 | Ga0496110_0185063_16_1077 | 353 |
| 8 | 3300046473 | Ga0495582_0000001 | Ga0495582_0000001_210089_211228 | 363 |
| 9 | 3300046683 | Ga0495658_0000193 | Ga0495658_0000193_13392_14531 | 363 |
| 10 | 3300046516 | Ga0495628_0078105 | Ga0495628_0078105_1032_2132 | 366 |
| 11 | 3300046499 | Ga0495594_0125555 | Ga0495594_0125555_170_1309 | 367 |
| 12 | 3300046517 | Ga0495630_0000012 | Ga0495630_0000012_217452_218672 | 367 |
| 13 | 3300044694 | Ga0466963_0106532 | Ga0466963_0106532_406_1515 | 369 |
| 14 | 3300044719 | Ga0466971_0012532 | Ga0466971_0012532_1633_2742 | 369 |
| 15 | 3300006237 | Ga0097621_100116678 | Ga0097621_1001166783 | 370 |
| 16 | 3300006358 | Ga0068871_100340113 | Ga0068871_1003401132 | 370 |
| 17 | 3300048911 | Ga0496108_0001109 | Ga0496108_0001109_8168_9307 | 370 |
| 18 | 3300048912 | Ga0496109_0001414 | Ga0496109_0001414_1949_3088 | 370 |
| 19 | 3300005341 | Ga0070691_10009524 | Ga0070691_100095242 | 371 |
| 20 | 3300013308 | Ga0157375_10008154 | Ga0157375_100081544 | 371 |
| 21 | 3300044694 | Ga0466963_0066096 | Ga0466963_0066096_327_1466 | 371 |
| 22 | 3300048922 | Ga0496119_0000055 | Ga0496119_0000055_132693_133808 | 371 |
| 23 | 3300044901 | Ga0466960_0000033 | Ga0466960_0000033_10875_12008 | 375 |
| 24 | 3300044901 | Ga0466960_0057097 | Ga0466960_0057097_139_1272 | 375 |
| 25 | 3300046471 | Ga0495650_0000398 | Ga0495650_0000398_30922_32055 | 375 |
| 26 | 3300046689 | Ga0495613_0111304 | Ga0495613_0111304_351_1481 | 375 |
| 27 | 3300006038 | Ga0075365_10030559 | Ga0075365_100305592 | 376 |
| 28 | 3300006038 | Ga0075365_10092060 | Ga0075365_100920602 | 376 |
| 29 | 3300006051 | Ga0075364_10054857 | Ga0075364_100548573 | 376 |
| 30 | 3300049571 | Ga0501034_0019495 | Ga0501034_0019495_1919_3049 | 376 |
| 31 | 3300049571 | Ga0501034_0228135 | Ga0501034_0228135_340_1470 | 376 |
| 32 | 3300049581 | Ga0501047_0046520 | Ga0501047_0046520_1131_2261 | 376 |
| 33 | 3300049823 | Ga0501044_0015577 | Ga0501044_0015577_4912_6042 | 376 |
| 34 | 3300050492 | nmdc:mga0yw44_33607_c1 | nmdc:mga0yw44_33607_c1_1350_2480 | 376 |
| 35 | 3300050492 | nmdc:mga0yw44_94602_c1 | nmdc:mga0yw44_94602_c1_460_1590 | 376 |
| 36 | 3300009551 | Ga0105238_10000048 | Ga0105238_10000048120 | 378 |
| 37 | 3300025924 | Ga0207694_10000056 | Ga0207694_10000056120 | 378 |
| 38 | 3300025927 | Ga0207687_10001900 | Ga0207687_100019009 | 378 |
| 39 | 3300046681 | Ga0495647_0000043 | Ga0495647_0000043_13277_14416 | 378 |
| 40 | 3300046689 | Ga0495613_0000282 | Ga0495613_0000282_22501_23640 | 378 |
| 41 | 3300046690 | Ga0495624_0006535 | Ga0495624_0006535_6623_7762 | 378 |
| 42 | 3300047321 | Ga0495676_0010974 | Ga0495676_0010974_3521_4660 | 378 |
| 43 | 3300047322 | Ga0495680_0005500 | Ga0495680_0005500_5092_6228 | 378 |
| 44 | 3300053077 | Ga0495601_0000156 | Ga0495601_0000156_21836_22972 | 378 |
| 45 | 3300002239 | JGI24034J26672_10000377 | JGI24034J26672_100003773 | 379 |
| 46 | 3300005338 | Ga0068868_100000633 | Ga0068868_10000063312 | 379 |
| 47 | 3300005341 | Ga0070691_10027617 | Ga0070691_100276172 | 379 |
| 48 | 3300005356 | Ga0070674_100000004 | Ga0070674_100000004148 | 379 |
| 49 | 3300005364 | Ga0070673_100000474 | Ga0070673_1000004745 | 379 |
| 50 | 3300005435 | Ga0070714_100186178 | Ga0070714_1001861782 | 379 |
| 51 | 3300005455 | Ga0070663_100125718 | Ga0070663_1001257182 | 379 |
| 52 | 3300005457 | Ga0070662_100000006 | Ga0070662_100000006149 | 379 |
| 53 | 3300005458 | Ga0070681_10003891 | Ga0070681_100038919 | 379 |
| 54 | 3300005459 | Ga0068867_100002668 | Ga0068867_1000026686 | 379 |
| 55 | 3300005530 | Ga0070679_100000844 | Ga0070679_10000084413 | 379 |
| 56 | 3300005548 | Ga0070665_100000040 | Ga0070665_10000004020 | 379 |
| 57 | 3300005564 | Ga0070664_100038179 | Ga0070664_1000381793 | 379 |
| 58 | 3300005718 | Ga0068866_10000004 | Ga0068866_10000004185 | 379 |
| 59 | 3300005842 | Ga0068858_100001009 | Ga0068858_10000100911 | 379 |
| 60 | 3300005843 | Ga0068860_100118890 | Ga0068860_1001188901 | 379 |
| 61 | 3300006163 | Ga0070715_10000014 | Ga0070715_10000014146 | 379 |
| 62 | 3300006852 | Ga0075433_10000244 | Ga0075433_1000024413 | 379 |
| 63 | 3300009093 | Ga0105240_10337301 | Ga0105240_103373012 | 379 |
| 64 | 3300009098 | Ga0105245_10071389 | Ga0105245_100713892 | 379 |
| 65 | 3300009553 | Ga0105249_10059376 | Ga0105249_100593764 | 379 |
| 66 | 3300013296 | Ga0157374_10001900 | Ga0157374_100019005 | 379 |
| 67 | 3300014326 | Ga0157380_10000507 | Ga0157380_1000050719 | 379 |
| 68 | 3300014968 | Ga0157379_10014841 | Ga0157379_100148415 | 379 |
| 69 | 3300017792 | Ga0163161_10000160 | Ga0163161_1000016039 | 379 |
| 70 | 3300025893 | Ga0207682_10000140 | Ga0207682_100001409 | 379 |
| 71 | 3300025899 | Ga0207642_10000005 | Ga0207642_1000000523 | 379 |
| 72 | 3300025905 | Ga0207685_10000025 | Ga0207685_1000002521 | 379 |
| 73 | 3300025913 | Ga0207695_10254870 | Ga0207695_102548702 | 379 |
| 74 | 3300025916 | Ga0207663_10000748 | Ga0207663_1000074811 | 379 |
| 75 | 3300025927 | Ga0207687_10000020 | Ga0207687_1000002020 | 379 |
| 76 | 3300025933 | Ga0207706_10000017 | Ga0207706_10000017149 | 379 |
| 77 | 3300025934 | Ga0207686_10000199 | Ga0207686_1000019921 | 379 |
| 78 | 3300025936 | Ga0207670_10056756 | Ga0207670_100567562 | 379 |
| 79 | 3300025937 | Ga0207669_10000131 | Ga0207669_1000013121 | 379 |
| 80 | 3300025944 | Ga0207661_10067537 | Ga0207661_100675374 | 379 |
| 81 | 3300025945 | Ga0207679_10020749 | Ga0207679_100207494 | 379 |
| 82 | 3300025960 | Ga0207651_10000664 | Ga0207651_100006645 | 379 |
| 83 | 3300026023 | Ga0207677_10001178 | Ga0207677_1000117812 | 379 |
| 84 | 3300026035 | Ga0207703_10000166 | Ga0207703_1000016658 | 379 |
| 85 | 3300026041 | Ga0207639_10210063 | Ga0207639_102100632 | 379 |
| 86 | 3300026067 | Ga0207678_10105781 | Ga0207678_101057812 | 379 |
| 87 | 3300026078 | Ga0207702_10004436 | Ga0207702_100044369 | 379 |
| 88 | 3300026089 | Ga0207648_10001799 | Ga0207648_1000179920 | 379 |
| 89 | 3300028379 | Ga0268266_10000045 | Ga0268266_1000004523 | 379 |
| 90 | 3300028556 | Ga0265337_1000805 | Ga0265337_100080510 | 379 |
| 91 | 3300028558 | Ga0265326_10000084 | Ga0265326_1000008422 | 379 |
| 92 | 3300028654 | Ga0265322_10000198 | Ga0265322_1000019822 | 379 |
| 93 | 3300029957 | Ga0265324_10023816 | Ga0265324_100238161 | 379 |
| 94 | 3300031238 | Ga0265332_10037936 | Ga0265332_100379361 | 379 |
| 95 | 3300031239 | Ga0265328_10017656 | Ga0265328_100176563 | 379 |
| 96 | 3300031240 | Ga0265320_10000035 | Ga0265320_1000003599 | 379 |
| 97 | 3300031242 | Ga0265329_10019214 | Ga0265329_100192141 | 379 |
| 98 | 3300031250 | Ga0265331_10023158 | Ga0265331_100231583 | 379 |
| 99 | 3300031251 | Ga0265327_10000015 | Ga0265327_10000015399 | 379 |
| 100 | 3300031344 | Ga0265316_10027343 | Ga0265316_100273433 | 379 |
| 101 | 3300031595 | Ga0265313_10109429 | Ga0265313_101094291 | 379 |
| 102 | 3300031711 | Ga0265314_10000690 | Ga0265314_1000069016 | 379 |
| 103 | 3300031712 | Ga0265342_10118561 | Ga0265342_101185612 | 379 |
| 104 | 3300035172 | Ga0373955_0028899 | Ga0373955_0028899_1502_2641 | 379 |
| 105 | 3300036401 | Ga0373937_0007200 | Ga0373937_0007200_3375_4517 | 379 |
| 106 | 3300036401 | Ga0373937_0285134 | Ga0373937_0285134_228_1367 | 379 |
| 107 | 3300041512 | Ga0451853_1338654 | Ga0451853_1338654_438_1577 | 379 |
| 108 | 3300044694 | Ga0466963_0000022 | Ga0466963_0000022_24933_26075 | 379 |
| 109 | 3300046454 | Ga0495592_0000912 | Ga0495592_0000912_18630_19772 | 379 |
| 110 | 3300046459 | Ga0495629_0022340 | Ga0495629_0022340_1246_2391 | 379 |
| 111 | 3300046460 | Ga0495638_0093251 | Ga0495638_0093251_178_1317 | 379 |
| 112 | 3300046462 | Ga0495651_0138823 | Ga0495651_0138823_284_1426 | 379 |
| 113 | 3300046463 | Ga0495653_0033150 | Ga0495653_0033150_356_1501 | 379 |
| 114 | 3300046476 | Ga0495662_0000133 | Ga0495662_0000133_5268_6407 | 379 |
| 115 | 3300046511 | Ga0495608_0003019 | Ga0495608_0003019_9200_10339 | 379 |
| 116 | 3300046511 | Ga0495608_0037719 | Ga0495608_0037719_495_1634 | 379 |
| 117 | 3300046515 | Ga0495620_0002158 | Ga0495620_0002158_662_1801 | 379 |
| 118 | 3300046516 | Ga0495628_0022200 | Ga0495628_0022200_2808_3950 | 379 |
| 119 | 3300046517 | Ga0495630_0003163 | Ga0495630_0003163_805_1947 | 379 |
| 120 | 3300046517 | Ga0495630_0064844 | Ga0495630_0064844_1577_2716 | 379 |
| 121 | 3300046529 | Ga0495652_0004585 | Ga0495652_0004585_8673_9812 | 379 |
| 122 | 3300046533 | Ga0495640_0007812 | Ga0495640_0007812_4318_5460 | 379 |
| 123 | 3300046536 | Ga0495587_0074999 | Ga0495587_0074999_480_1619 | 379 |
| 124 | 3300046539 | Ga0495621_0001449 | Ga0495621_0001449_3967_5106 | 379 |
| 125 | 3300046543 | Ga0495645_0032740 | Ga0495645_0032740_186_1325 | 379 |
| 126 | 3300046543 | Ga0495645_0073531 | Ga0495645_0073531_296_1435 | 379 |
| 127 | 3300046543 | Ga0495645_0103932 | Ga0495645_0103932_559_1698 | 379 |
| 128 | 3300046615 | Ga0495656_0000295 | Ga0495656_0000295_476_1618 | 379 |
| 129 | 3300046642 | Ga0495634_0010503 | Ga0495634_0010503_3632_4771 | 379 |
| 130 | 3300046675 | Ga0495657_0006985 | Ga0495657_0006985_883_2025 | 379 |
| 131 | 3300046675 | Ga0495657_0155255 | Ga0495657_0155255_182_1321 | 379 |
| 132 | 3300046684 | Ga0495669_0000102 | Ga0495669_0000102_29573_30715 | 379 |
| 133 | 3300046689 | Ga0495613_0030444 | Ga0495613_0030444_1448_2587 | 379 |
| 134 | 3300046689 | Ga0495613_0074173 | Ga0495613_0074173_910_2049 | 379 |
| 135 | 3300046689 | Ga0495613_0162278 | Ga0495613_0162278_33_1175 | 379 |
| 136 | 3300046809 | Ga0495600_0001288 | Ga0495600_0001288_12114_13256 | 379 |
| 137 | 3300047317 | Ga0495604_0000267 | Ga0495604_0000267_20986_22125 | 379 |
| 138 | 3300047317 | Ga0495604_0028724 | Ga0495604_0028724_2086_3228 | 379 |
| 139 | 3300047321 | Ga0495676_0001626 | Ga0495676_0001626_1240_2385 | 379 |
| 140 | 3300047321 | Ga0495676_0018201 | Ga0495676_0018201_1148_2293 | 379 |
| 141 | 3300047322 | Ga0495680_0000193 | Ga0495680_0000193_21765_22907 | 379 |
| 142 | 3300048903 | Ga0496100_0000005 | Ga0496100_0000005_22562_23707 | 379 |
| 143 | 3300048903 | Ga0496100_0000014 | Ga0496100_0000014_26550_27692 | 379 |
| 144 | 3300048904 | Ga0496101_0000036 | Ga0496101_0000036_27154_28296 | 379 |
| 145 | 3300048904 | Ga0496101_0000493 | Ga0496101_0000493_1250_2395 | 379 |
| 146 | 3300048907 | Ga0496104_0000024 | Ga0496104_0000024_24749_25891 | 379 |
| 147 | 3300048908 | Ga0496105_0000013 | Ga0496105_0000013_204023_205165 | 379 |
| 148 | 3300048909 | Ga0496106_0000043 | Ga0496106_0000043_81739_82881 | 379 |
| 149 | 3300048909 | Ga0496106_0000193 | Ga0496106_0000193_22512_23657 | 379 |
| 150 | 3300048909 | Ga0496106_0001892 | Ga0496106_0001892_989_2128 | 379 |
| 151 | 3300048910 | Ga0496107_0000094 | Ga0496107_0000094_22381_23526 | 379 |
| 152 | 3300048910 | Ga0496107_0000271 | Ga0496107_0000271_22971_24113 | 379 |
| 153 | 3300048911 | Ga0496108_0051885 | Ga0496108_0051885_374_1516 | 379 |
| 154 | 3300048912 | Ga0496109_0000004 | Ga0496109_0000004_377482_378624 | 379 |
| 155 | 3300048916 | Ga0496113_0099741 | Ga0496113_0099741_839_1978 | 379 |
| 156 | 3300048916 | Ga0496113_0245217 | Ga0496113_0245217_57_1196 | 379 |
| 157 | 3300048917 | Ga0496114_0018100 | Ga0496114_0018100_1044_2186 | 379 |
| 158 | 3300048918 | Ga0496115_0000010 | Ga0496115_0000010_203603_204748 | 379 |
| 159 | 3300048918 | Ga0496115_0001569 | Ga0496115_0001569_9633_10775 | 379 |
| 160 | 3300048928 | Ga0496125_0052525 | Ga0496125_0052525_314_1456 | 379 |
| 161 | 3300049591 | Ga0501075_0003224 | Ga0501075_0003224_8239_9378 | 379 |
| 162 | 3300049743 | Ga0501081_0066390 | Ga0501081_0066390_1283_2422 | 379 |
| 163 | 3300050515 | nmdc:mga0a205_45_c1 | nmdc:mga0a205_45_c1_20664_21806 | 379 |
| 164 | 3300053078 | Ga0495612_0003529 | Ga0495612_0003529_4245_5384 | 379 |
| 165 | 3300053083 | Ga0495655_0000023 | Ga0495655_0000023_13591_14736 | 379 |
| 166 | 3300053084 | Ga0495595_0000200 | Ga0495595_0000200_21818_22957 | 379 |
| 167 | 3300053085 | Ga0495619_0000602 | Ga0495619_0000602_4467_5609 | 379 |
| 168 | 3300053085 | Ga0495619_0002992 | Ga0495619_0002992_310_1452 | 379 |
| 169 | 3300053085 | Ga0495619_0003076 | Ga0495619_0003076_8244_9383 | 379 |
| 170 | 3300053085 | Ga0495619_0025796 | Ga0495619_0025796_63_1202 | 379 |
| 171 | 3300053129 | Ga0500628_000001 | Ga0500628_000001_427731_428876 | 379 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3vom-assembly1.cif.gz_B | structure of a putative phosphoserine aminotransferase from mycobacterium tuberculosis | 0.9706 | 7 | 372 |
| 2fyf-assembly1.cif.gz_B | structure of a putative phosphoserine aminotransferase from mycobacterium tuberculosis | 0.9703 | 7 | 372 |
| 3vom-assembly1.cif.gz_B | structure of a putative phosphoserine aminotransferase from mycobacterium tuberculosis | 0.9628 | 7 | 372 |
| 2fyf-assembly1.cif.gz_B | structure of a putative phosphoserine aminotransferase from mycobacterium tuberculosis | 0.9599 | 7 | 372 |
| 3ffr-assembly1.cif.gz_A-2 | crystal structure of a phosphoserine aminotransferase serc (chu_0995) from cytophaga hutchinsonii atcc 33406 at 1.75 a resolution | 0.8889 | 23 | 371 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WQ73_31_269_3.20.10.10 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.976 | 30 | 266 | 3.20.10.10 |
| af_P9WQ73_31_269_3.20.10.10 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.964 | 30 | 266 | 3.20.10.10 |
| af_P9WQ73_272_376_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9585 | 270 | 372 | 3.90.1150.10 |
| af_P9WQ73_272_376_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9322 | 270 | 372 | 3.90.1150.10 |
| 3ffrA02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.8749 | 30 | 264 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B3FJM8-F1-model_v4 | Aminotransferase class V-fold PLP-dependent enzyme | 0.9842 | 50 | 203 |
GO:0004760
GO:0005777 GO:0008453 GO:0019265 |
| AF-A0A2S9FBJ7-F1-model_v4 | phosphoserine transaminase (EC 2.6.1.52) (Phosphohydroxythreonine aminotransferase) | 0.9831 | 49 | 373 |
GO:0004648
GO:0004760 GO:0005777 GO:0006564 GO:0008453 GO:0008615 GO:0019265 |
| AF-A0A7G1I7M0-F1-model_v4 | Aminotransferase class V domain-containing protein | 0.9817 | 99 | 197 |
|
| AF-A0A7W1KBB2-F1-model_v4 | Phosphoserine transaminase (EC 2.6.1.52) | 0.9814 | 92 | 372 |
GO:0004648
GO:0004760 GO:0005777 GO:0006564 GO:0008453 GO:0008615 GO:0019265 |
| AF-A0A6J6HXD8-F1-model_v4 | Unannotated protein | 0.9792 | 77 | 373 |
GO:0004648
GO:0004760 GO:0005777 GO:0006564 GO:0008453 GO:0019265 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar