F259407

General Info

Members Datasets Scaffolds Average Seq Length
171 132 171 377

Family's Representative Sequence

Representative Sequence 3300046691|Ga0495670_0033773|Ga0495670_0033773_1434_2495
Length 344
Sequence VRPDALARLAEQSALMGTSHRQKPVRDLVARVRGGLADLFSLPDGYEIVLGNGGTTAFWDAAAAWLVRERALHLSYGEFSQKFAKVTAAAPFLADSILVEADPGDAPAPVWAHNETSTGVMVAVARPEGAGEALVLVDATSGAGGLPLDASQADAYYFAPQKAFGADGGLWLAALSPAAIARIEQLDGAADRWQPAFLSLQTALENSRKEQTYNTPALATLLLLADQVEWMLAGGGLNWCVERTSASSGHLYGWAERTDFASPFVADPAKRSLVVGTIDFDDSVDAAAVAATLRANGIVDVEPYRKLGRNQLRIGMFPSVEPADVEALTACIDWVVENVGEARS

Samples

Sample ID Description Type Environment
1 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
20 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
31 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
32 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
54 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
55 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
56 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
57 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
58 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
59 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
60 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
61 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
62 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
65 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
66 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
67 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
68 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
69 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
70 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
71 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
72 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
75 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
76 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
77 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
78 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
79 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
80 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
81 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
82 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
83 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
84 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
85 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
86 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
87 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
88 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
89 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
90 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
91 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
92 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
93 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
94 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
95 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
96 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
97 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
100 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
101 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
102 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
103 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
104 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
105 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
106 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
107 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
111 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
112 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
113 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
116 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
117 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
118 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
119 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
126 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
127 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
128 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
129 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
130 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
131 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
132 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.51
Nodule 0
Rhizoplane 12.28
Rhizosphere 82.46
Stem 0
Stem Tuber 0
Unclassified 1.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10000377 3300002239 Bacteria 5789
2 Ga0068868_100000633 3300005338 Bacteria 23661
3 Ga0070691_10009524 3300005341 Bacteria 4435
4 Ga0070691_10027617 3300005341 Bacteria 2649
5 Ga0070674_100000004 3300005356 Bacteria 169446
6 Ga0070673_100000474 3300005364 Bacteria 21373
7 Ga0070714_100186178 3300005435 Bacteria 1892
8 Ga0070663_100125718 3300005455 Bacteria 1942
9 Ga0070662_100000006 3300005457 Bacteria 169366
10 Ga0070681_10003891 3300005458 Bacteria 14065
11 Ga0068867_100002668 3300005459 Bacteria 12591
12 Ga0070679_100000844 3300005530 Bacteria 26718
13 Ga0070665_100000040 3300005548 Bacteria 305480
14 Ga0070664_100038179 3300005564 Bacteria 4042
15 Ga0068866_10000004 3300005718 Bacteria 202810
16 Ga0068858_100001009 3300005842 Bacteria 29022
17 Ga0068860_100118890 3300005843 Bacteria 2530
18 Ga0075365_10030559 3300006038 Bacteria 3451
19 Ga0075365_10092060 3300006038 Bacteria 2067
20 Ga0075364_10054857 3300006051 Bacteria 2607
21 Ga0070715_10000014 3300006163 Bacteria 154272
22 Ga0097621_100116678 3300006237 Bacteria 2261
23 Ga0068871_100340113 3300006358 Bacteria 1325
24 Ga0075433_10000244 3300006852 Bacteria 31446
25 Ga0105240_10337301 3300009093 Bacteria 1713
26 Ga0105245_10071389 3300009098 Bacteria 3153
27 Ga0105238_10000048 3300009551 Bacteria 146322
28 Ga0105249_10059376 3300009553 Bacteria 3507
29 Ga0157374_10001900 3300013296 Bacteria 17502
30 Ga0157375_10008154 3300013308 Bacteria 9167
31 Ga0157380_10000507 3300014326 Bacteria 23819
32 Ga0157379_10014841 3300014968 Bacteria 6832
33 Ga0163161_10000160 3300017792 Bacteria 62228
34 Ga0207682_10000140 3300025893 Bacteria 32624
35 Ga0207642_10000005 3300025899 Bacteria 401934
36 Ga0207685_10000025 3300025905 Bacteria 110358
37 Ga0207695_10254870 3300025913 Bacteria 1653
38 Ga0207663_10000748 3300025916 Bacteria 14481
39 Ga0207694_10000056 3300025924 Bacteria 146908
40 Ga0207687_10000020 3300025927 Bacteria 228407
41 Ga0207687_10001900 3300025927 Bacteria 14372
42 Ga0207706_10000017 3300025933 Bacteria 169589
43 Ga0207686_10000199 3300025934 Bacteria 46373
44 Ga0207670_10056756 3300025936 Bacteria 2653
45 Ga0207669_10000131 3300025937 Bacteria 37319
46 Ga0207661_10067537 3300025944 Bacteria 2908
47 Ga0207679_10020749 3300025945 Bacteria 4440
48 Ga0207651_10000664 3300025960 Bacteria 14678
49 Ga0207677_10001178 3300026023 Bacteria 14220
50 Ga0207703_10000166 3300026035 Bacteria 76553
51 Ga0207639_10210063 3300026041 Bacteria 1675
52 Ga0207678_10105781 3300026067 Bacteria 2401
53 Ga0207702_10004436 3300026078 Bacteria 12465
54 Ga0207648_10001799 3300026089 Bacteria 23490
55 Ga0268266_10000045 3300028379 Bacteria 312955
56 Ga0265337_1000805 3300028556 Bacteria 16508
57 Ga0265326_10000084 3300028558 Bacteria 50129
58 Ga0265322_10000198 3300028654 Bacteria 26588
59 Ga0265324_10023816 3300029957 Bacteria 2178
60 Ga0265332_10037936 3300031238 Bacteria 2089
61 Ga0265328_10017656 3300031239 Bacteria 2761
62 Ga0265320_10000035 3300031240 Bacteria 137855
63 Ga0265329_10019214 3300031242 Bacteria 2323
64 Ga0265331_10023158 3300031250 Bacteria 3160
65 Ga0265327_10000015 3300031251 Bacteria 496677
66 Ga0265316_10027343 3300031344 Bacteria 4725
67 Ga0265313_10109429 3300031595 Bacteria 1216
68 Ga0265314_10000690 3300031711 Bacteria 40955
69 Ga0265342_10118561 3300031712 Bacteria 1492
70 Ga0373955_0028899 3300035172 Bacteria 2879
71 Ga0373937_0007200 3300036401 Bacteria 9627
72 Ga0373937_0285134 3300036401 Bacteria 1560
73 Ga0451853_1338654 3300041512 Bacteria 1858
74 Ga0466963_0000022 3300044694 Bacteria 52600
75 Ga0466963_0066096 3300044694 Bacteria 2425
76 Ga0466963_0106532 3300044694 Bacteria 1922
77 Ga0466971_0012532 3300044719 Bacteria 3718
78 Ga0466960_0000033 3300044901 Bacteria 46153
79 Ga0466960_0057097 3300044901 Bacteria 1902
80 Ga0466967_0326441 3300045976 Bacteria 1481
81 Ga0495592_0000912 3300046454 Bacteria 20489
82 Ga0495629_0022340 3300046459 Bacteria 4511
83 Ga0495638_0093251 3300046460 Bacteria 1811
84 Ga0495651_0138823 3300046462 Bacteria 1765
85 Ga0495653_0033150 3300046463 Bacteria 4094
86 Ga0495650_0000398 3300046471 Bacteria 72672
87 Ga0495582_0000001 3300046473 Bacteria 252434
88 Ga0495662_0000133 3300046476 Bacteria 28271
89 Ga0495594_0125555 3300046499 Bacteria 1452
90 Ga0495608_0003019 3300046511 Bacteria 12014
91 Ga0495608_0037719 3300046511 Bacteria 3249
92 Ga0495620_0002158 3300046515 Bacteria 11431
93 Ga0495628_0022200 3300046516 Bacteria 5216
94 Ga0495628_0078105 3300046516 Bacteria 2574
95 Ga0495628_0154434 3300046516 Bacteria 1747
96 Ga0495630_0000012 3300046517 Bacteria 223330
97 Ga0495630_0003163 3300046517 Bacteria 11429
98 Ga0495630_0064844 3300046517 Bacteria 2745
99 Ga0495652_0004585 3300046529 Bacteria 13174
100 Ga0495640_0007812 3300046533 Bacteria 8414
101 Ga0495587_0074999 3300046536 Bacteria 1964
102 Ga0495621_0001449 3300046539 Bacteria 6146
103 Ga0495645_0032740 3300046543 Bacteria 3792
104 Ga0495645_0073531 3300046543 Bacteria 2462
105 Ga0495645_0103932 3300046543 Bacteria 2018
106 Ga0495656_0000295 3300046615 Bacteria 17274
107 Ga0495634_0010503 3300046642 Bacteria 6783
108 Ga0495657_0006985 3300046675 Bacteria 8756
109 Ga0495657_0155255 3300046675 Bacteria 1419
110 Ga0495647_0000043 3300046681 Bacteria 36874
111 Ga0495658_0000193 3300046683 Bacteria 35142
112 Ga0495669_0000102 3300046684 Bacteria 53777
113 Ga0495613_0000282 3300046689 Bacteria 47001
114 Ga0495613_0030444 3300046689 Bacteria 4009
115 Ga0495613_0074173 3300046689 Bacteria 2478
116 Ga0495613_0111304 3300046689 Bacteria 1972
117 Ga0495613_0162278 3300046689 Bacteria 1589
118 Ga0495624_0006535 3300046690 Bacteria 8263
119 Ga0495670_0033773 3300046691 Bacteria 2546
120 Ga0495600_0001288 3300046809 Bacteria 13857
121 Ga0495600_0299081 3300046809 Bacteria 1015
122 Ga0495604_0000267 3300047317 Bacteria 46398
123 Ga0495604_0028724 3300047317 Bacteria 4425
124 Ga0495676_0001626 3300047321 Bacteria 19533
125 Ga0495676_0010974 3300047321 Bacteria 8192
126 Ga0495676_0018201 3300047321 Bacteria 6197
127 Ga0495680_0000193 3300047322 Bacteria 65567
128 Ga0495680_0005500 3300047322 Bacteria 11903
129 Ga0495679_023349 3300047446 Bacteria 2099
130 Ga0496100_0000005 3300048903 Bacteria 312112
131 Ga0496100_0000014 3300048903 Bacteria 174991
132 Ga0496101_0000036 3300048904 Bacteria 175595
133 Ga0496101_0000493 3300048904 Bacteria 24897
134 Ga0496104_0000024 3300048907 Bacteria 229913
135 Ga0496105_0000013 3300048908 Bacteria 229894
136 Ga0496106_0000043 3300048909 Bacteria 105477
137 Ga0496106_0000193 3300048909 Bacteria 42951
138 Ga0496106_0001892 3300048909 Bacteria 15675
139 Ga0496107_0000094 3300048910 Bacteria 42797
140 Ga0496107_0000271 3300048910 Bacteria 27463
141 Ga0496108_0001109 3300048911 Bacteria 21079
142 Ga0496108_0051885 3300048911 Bacteria 3436
143 Ga0496109_0000004 3300048912 Bacteria 404818
144 Ga0496109_0001414 3300048912 Bacteria 19912
145 Ga0496110_0185063 3300048913 Bacteria 1891
146 Ga0496113_0099741 3300048916 Bacteria 2249
147 Ga0496113_0245217 3300048916 Bacteria 1430
148 Ga0496114_0018100 3300048917 Bacteria 5693
149 Ga0496115_0000010 3300048918 Bacteria 227112
150 Ga0496115_0001569 3300048918 Bacteria 16428
151 Ga0496119_0000055 3300048922 Bacteria 180121
152 Ga0496125_0052525 3300048928 Bacteria 3351
153 Ga0501034_0019495 3300049571 Bacteria 6937
154 Ga0501034_0228135 3300049571 Bacteria 1812
155 Ga0501047_0046520 3300049581 Bacteria 4194
156 Ga0501075_0003224 3300049591 Bacteria 10913
157 Ga0501081_0066390 3300049743 Bacteria 2509
158 Ga0501044_0015577 3300049823 Bacteria 8192
159 nmdc:mga0yw44_33607_c1 3300050492 Bacteria 2998
160 nmdc:mga0yw44_94602_c1 3300050492 Bacteria 1894
161 nmdc:mga0a205_45_c1 3300050515 Bacteria 68070
162 Ga0495601_0000156 3300053077 Bacteria 38350
163 Ga0495612_0003529 3300053078 Bacteria 6484
164 Ga0495655_0000023 3300053083 Bacteria 39507
165 Ga0495595_0000200 3300053084 Bacteria 24133
166 Ga0495595_0023189 3300053084 Bacteria 2730
167 Ga0495619_0000602 3300053085 Bacteria 23838
168 Ga0495619_0002992 3300053085 Bacteria 10976
169 Ga0495619_0003076 3300053085 Bacteria 10833
170 Ga0495619_0025796 3300053085 Bacteria 3777
171 Ga0500628_000001 3300053129 Bacteria 564074

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046809 Ga0495600_0299081 Ga0495600_0299081_11_991 326
2 3300053084 Ga0495595_0023189 Ga0495595_0023189_1699_2700 332
3 3300046516 Ga0495628_0154434 Ga0495628_0154434_16_1032 338
4 3300046691 Ga0495670_0033773 Ga0495670_0033773_1434_2495 344
5 3300045976 Ga0466967_0326441 Ga0466967_0326441_114_1169 351
6 3300047446 Ga0495679_023349 Ga0495679_023349_61_1122 353
7 3300048913 Ga0496110_0185063 Ga0496110_0185063_16_1077 353
8 3300046473 Ga0495582_0000001 Ga0495582_0000001_210089_211228 363
9 3300046683 Ga0495658_0000193 Ga0495658_0000193_13392_14531 363
10 3300046516 Ga0495628_0078105 Ga0495628_0078105_1032_2132 366
11 3300046499 Ga0495594_0125555 Ga0495594_0125555_170_1309 367
12 3300046517 Ga0495630_0000012 Ga0495630_0000012_217452_218672 367
13 3300044694 Ga0466963_0106532 Ga0466963_0106532_406_1515 369
14 3300044719 Ga0466971_0012532 Ga0466971_0012532_1633_2742 369
15 3300006237 Ga0097621_100116678 Ga0097621_1001166783 370
16 3300006358 Ga0068871_100340113 Ga0068871_1003401132 370
17 3300048911 Ga0496108_0001109 Ga0496108_0001109_8168_9307 370
18 3300048912 Ga0496109_0001414 Ga0496109_0001414_1949_3088 370
19 3300005341 Ga0070691_10009524 Ga0070691_100095242 371
20 3300013308 Ga0157375_10008154 Ga0157375_100081544 371
21 3300044694 Ga0466963_0066096 Ga0466963_0066096_327_1466 371
22 3300048922 Ga0496119_0000055 Ga0496119_0000055_132693_133808 371
23 3300044901 Ga0466960_0000033 Ga0466960_0000033_10875_12008 375
24 3300044901 Ga0466960_0057097 Ga0466960_0057097_139_1272 375
25 3300046471 Ga0495650_0000398 Ga0495650_0000398_30922_32055 375
26 3300046689 Ga0495613_0111304 Ga0495613_0111304_351_1481 375
27 3300006038 Ga0075365_10030559 Ga0075365_100305592 376
28 3300006038 Ga0075365_10092060 Ga0075365_100920602 376
29 3300006051 Ga0075364_10054857 Ga0075364_100548573 376
30 3300049571 Ga0501034_0019495 Ga0501034_0019495_1919_3049 376
31 3300049571 Ga0501034_0228135 Ga0501034_0228135_340_1470 376
32 3300049581 Ga0501047_0046520 Ga0501047_0046520_1131_2261 376
33 3300049823 Ga0501044_0015577 Ga0501044_0015577_4912_6042 376
34 3300050492 nmdc:mga0yw44_33607_c1 nmdc:mga0yw44_33607_c1_1350_2480 376
35 3300050492 nmdc:mga0yw44_94602_c1 nmdc:mga0yw44_94602_c1_460_1590 376
36 3300009551 Ga0105238_10000048 Ga0105238_10000048120 378
37 3300025924 Ga0207694_10000056 Ga0207694_10000056120 378
38 3300025927 Ga0207687_10001900 Ga0207687_100019009 378
39 3300046681 Ga0495647_0000043 Ga0495647_0000043_13277_14416 378
40 3300046689 Ga0495613_0000282 Ga0495613_0000282_22501_23640 378
41 3300046690 Ga0495624_0006535 Ga0495624_0006535_6623_7762 378
42 3300047321 Ga0495676_0010974 Ga0495676_0010974_3521_4660 378
43 3300047322 Ga0495680_0005500 Ga0495680_0005500_5092_6228 378
44 3300053077 Ga0495601_0000156 Ga0495601_0000156_21836_22972 378
45 3300002239 JGI24034J26672_10000377 JGI24034J26672_100003773 379
46 3300005338 Ga0068868_100000633 Ga0068868_10000063312 379
47 3300005341 Ga0070691_10027617 Ga0070691_100276172 379
48 3300005356 Ga0070674_100000004 Ga0070674_100000004148 379
49 3300005364 Ga0070673_100000474 Ga0070673_1000004745 379
50 3300005435 Ga0070714_100186178 Ga0070714_1001861782 379
51 3300005455 Ga0070663_100125718 Ga0070663_1001257182 379
52 3300005457 Ga0070662_100000006 Ga0070662_100000006149 379
53 3300005458 Ga0070681_10003891 Ga0070681_100038919 379
54 3300005459 Ga0068867_100002668 Ga0068867_1000026686 379
55 3300005530 Ga0070679_100000844 Ga0070679_10000084413 379
56 3300005548 Ga0070665_100000040 Ga0070665_10000004020 379
57 3300005564 Ga0070664_100038179 Ga0070664_1000381793 379
58 3300005718 Ga0068866_10000004 Ga0068866_10000004185 379
59 3300005842 Ga0068858_100001009 Ga0068858_10000100911 379
60 3300005843 Ga0068860_100118890 Ga0068860_1001188901 379
61 3300006163 Ga0070715_10000014 Ga0070715_10000014146 379
62 3300006852 Ga0075433_10000244 Ga0075433_1000024413 379
63 3300009093 Ga0105240_10337301 Ga0105240_103373012 379
64 3300009098 Ga0105245_10071389 Ga0105245_100713892 379
65 3300009553 Ga0105249_10059376 Ga0105249_100593764 379
66 3300013296 Ga0157374_10001900 Ga0157374_100019005 379
67 3300014326 Ga0157380_10000507 Ga0157380_1000050719 379
68 3300014968 Ga0157379_10014841 Ga0157379_100148415 379
69 3300017792 Ga0163161_10000160 Ga0163161_1000016039 379
70 3300025893 Ga0207682_10000140 Ga0207682_100001409 379
71 3300025899 Ga0207642_10000005 Ga0207642_1000000523 379
72 3300025905 Ga0207685_10000025 Ga0207685_1000002521 379
73 3300025913 Ga0207695_10254870 Ga0207695_102548702 379
74 3300025916 Ga0207663_10000748 Ga0207663_1000074811 379
75 3300025927 Ga0207687_10000020 Ga0207687_1000002020 379
76 3300025933 Ga0207706_10000017 Ga0207706_10000017149 379
77 3300025934 Ga0207686_10000199 Ga0207686_1000019921 379
78 3300025936 Ga0207670_10056756 Ga0207670_100567562 379
79 3300025937 Ga0207669_10000131 Ga0207669_1000013121 379
80 3300025944 Ga0207661_10067537 Ga0207661_100675374 379
81 3300025945 Ga0207679_10020749 Ga0207679_100207494 379
82 3300025960 Ga0207651_10000664 Ga0207651_100006645 379
83 3300026023 Ga0207677_10001178 Ga0207677_1000117812 379
84 3300026035 Ga0207703_10000166 Ga0207703_1000016658 379
85 3300026041 Ga0207639_10210063 Ga0207639_102100632 379
86 3300026067 Ga0207678_10105781 Ga0207678_101057812 379
87 3300026078 Ga0207702_10004436 Ga0207702_100044369 379
88 3300026089 Ga0207648_10001799 Ga0207648_1000179920 379
89 3300028379 Ga0268266_10000045 Ga0268266_1000004523 379
90 3300028556 Ga0265337_1000805 Ga0265337_100080510 379
91 3300028558 Ga0265326_10000084 Ga0265326_1000008422 379
92 3300028654 Ga0265322_10000198 Ga0265322_1000019822 379
93 3300029957 Ga0265324_10023816 Ga0265324_100238161 379
94 3300031238 Ga0265332_10037936 Ga0265332_100379361 379
95 3300031239 Ga0265328_10017656 Ga0265328_100176563 379
96 3300031240 Ga0265320_10000035 Ga0265320_1000003599 379
97 3300031242 Ga0265329_10019214 Ga0265329_100192141 379
98 3300031250 Ga0265331_10023158 Ga0265331_100231583 379
99 3300031251 Ga0265327_10000015 Ga0265327_10000015399 379
100 3300031344 Ga0265316_10027343 Ga0265316_100273433 379
101 3300031595 Ga0265313_10109429 Ga0265313_101094291 379
102 3300031711 Ga0265314_10000690 Ga0265314_1000069016 379
103 3300031712 Ga0265342_10118561 Ga0265342_101185612 379
104 3300035172 Ga0373955_0028899 Ga0373955_0028899_1502_2641 379
105 3300036401 Ga0373937_0007200 Ga0373937_0007200_3375_4517 379
106 3300036401 Ga0373937_0285134 Ga0373937_0285134_228_1367 379
107 3300041512 Ga0451853_1338654 Ga0451853_1338654_438_1577 379
108 3300044694 Ga0466963_0000022 Ga0466963_0000022_24933_26075 379
109 3300046454 Ga0495592_0000912 Ga0495592_0000912_18630_19772 379
110 3300046459 Ga0495629_0022340 Ga0495629_0022340_1246_2391 379
111 3300046460 Ga0495638_0093251 Ga0495638_0093251_178_1317 379
112 3300046462 Ga0495651_0138823 Ga0495651_0138823_284_1426 379
113 3300046463 Ga0495653_0033150 Ga0495653_0033150_356_1501 379
114 3300046476 Ga0495662_0000133 Ga0495662_0000133_5268_6407 379
115 3300046511 Ga0495608_0003019 Ga0495608_0003019_9200_10339 379
116 3300046511 Ga0495608_0037719 Ga0495608_0037719_495_1634 379
117 3300046515 Ga0495620_0002158 Ga0495620_0002158_662_1801 379
118 3300046516 Ga0495628_0022200 Ga0495628_0022200_2808_3950 379
119 3300046517 Ga0495630_0003163 Ga0495630_0003163_805_1947 379
120 3300046517 Ga0495630_0064844 Ga0495630_0064844_1577_2716 379
121 3300046529 Ga0495652_0004585 Ga0495652_0004585_8673_9812 379
122 3300046533 Ga0495640_0007812 Ga0495640_0007812_4318_5460 379
123 3300046536 Ga0495587_0074999 Ga0495587_0074999_480_1619 379
124 3300046539 Ga0495621_0001449 Ga0495621_0001449_3967_5106 379
125 3300046543 Ga0495645_0032740 Ga0495645_0032740_186_1325 379
126 3300046543 Ga0495645_0073531 Ga0495645_0073531_296_1435 379
127 3300046543 Ga0495645_0103932 Ga0495645_0103932_559_1698 379
128 3300046615 Ga0495656_0000295 Ga0495656_0000295_476_1618 379
129 3300046642 Ga0495634_0010503 Ga0495634_0010503_3632_4771 379
130 3300046675 Ga0495657_0006985 Ga0495657_0006985_883_2025 379
131 3300046675 Ga0495657_0155255 Ga0495657_0155255_182_1321 379
132 3300046684 Ga0495669_0000102 Ga0495669_0000102_29573_30715 379
133 3300046689 Ga0495613_0030444 Ga0495613_0030444_1448_2587 379
134 3300046689 Ga0495613_0074173 Ga0495613_0074173_910_2049 379
135 3300046689 Ga0495613_0162278 Ga0495613_0162278_33_1175 379
136 3300046809 Ga0495600_0001288 Ga0495600_0001288_12114_13256 379
137 3300047317 Ga0495604_0000267 Ga0495604_0000267_20986_22125 379
138 3300047317 Ga0495604_0028724 Ga0495604_0028724_2086_3228 379
139 3300047321 Ga0495676_0001626 Ga0495676_0001626_1240_2385 379
140 3300047321 Ga0495676_0018201 Ga0495676_0018201_1148_2293 379
141 3300047322 Ga0495680_0000193 Ga0495680_0000193_21765_22907 379
142 3300048903 Ga0496100_0000005 Ga0496100_0000005_22562_23707 379
143 3300048903 Ga0496100_0000014 Ga0496100_0000014_26550_27692 379
144 3300048904 Ga0496101_0000036 Ga0496101_0000036_27154_28296 379
145 3300048904 Ga0496101_0000493 Ga0496101_0000493_1250_2395 379
146 3300048907 Ga0496104_0000024 Ga0496104_0000024_24749_25891 379
147 3300048908 Ga0496105_0000013 Ga0496105_0000013_204023_205165 379
148 3300048909 Ga0496106_0000043 Ga0496106_0000043_81739_82881 379
149 3300048909 Ga0496106_0000193 Ga0496106_0000193_22512_23657 379
150 3300048909 Ga0496106_0001892 Ga0496106_0001892_989_2128 379
151 3300048910 Ga0496107_0000094 Ga0496107_0000094_22381_23526 379
152 3300048910 Ga0496107_0000271 Ga0496107_0000271_22971_24113 379
153 3300048911 Ga0496108_0051885 Ga0496108_0051885_374_1516 379
154 3300048912 Ga0496109_0000004 Ga0496109_0000004_377482_378624 379
155 3300048916 Ga0496113_0099741 Ga0496113_0099741_839_1978 379
156 3300048916 Ga0496113_0245217 Ga0496113_0245217_57_1196 379
157 3300048917 Ga0496114_0018100 Ga0496114_0018100_1044_2186 379
158 3300048918 Ga0496115_0000010 Ga0496115_0000010_203603_204748 379
159 3300048918 Ga0496115_0001569 Ga0496115_0001569_9633_10775 379
160 3300048928 Ga0496125_0052525 Ga0496125_0052525_314_1456 379
161 3300049591 Ga0501075_0003224 Ga0501075_0003224_8239_9378 379
162 3300049743 Ga0501081_0066390 Ga0501081_0066390_1283_2422 379
163 3300050515 nmdc:mga0a205_45_c1 nmdc:mga0a205_45_c1_20664_21806 379
164 3300053078 Ga0495612_0003529 Ga0495612_0003529_4245_5384 379
165 3300053083 Ga0495655_0000023 Ga0495655_0000023_13591_14736 379
166 3300053084 Ga0495595_0000200 Ga0495595_0000200_21818_22957 379
167 3300053085 Ga0495619_0000602 Ga0495619_0000602_4467_5609 379
168 3300053085 Ga0495619_0002992 Ga0495619_0002992_310_1452 379
169 3300053085 Ga0495619_0003076 Ga0495619_0003076_8244_9383 379
170 3300053085 Ga0495619_0025796 Ga0495619_0025796_63_1202 379
171 3300053129 Ga0500628_000001 Ga0500628_000001_427731_428876 379

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00266

Aminotran_5

Aminotransferase class-V

110

301

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vom-assembly1.cif.gz_B structure of a putative phosphoserine aminotransferase from mycobacterium tuberculosis 0.9706 7 372
2fyf-assembly1.cif.gz_B structure of a putative phosphoserine aminotransferase from mycobacterium tuberculosis 0.9703 7 372
3vom-assembly1.cif.gz_B structure of a putative phosphoserine aminotransferase from mycobacterium tuberculosis 0.9628 7 372
2fyf-assembly1.cif.gz_B structure of a putative phosphoserine aminotransferase from mycobacterium tuberculosis 0.9599 7 372
3ffr-assembly1.cif.gz_A-2 crystal structure of a phosphoserine aminotransferase serc (chu_0995) from cytophaga hutchinsonii atcc 33406 at 1.75 a resolution 0.8889 23 371
ID Description Score Start End Superfamily
af_P9WQ73_31_269_3.20.10.10 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.976 30 266 3.20.10.10
af_P9WQ73_31_269_3.20.10.10 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.964 30 266 3.20.10.10
af_P9WQ73_272_376_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9585 270 372 3.90.1150.10
af_P9WQ73_272_376_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9322 270 372 3.90.1150.10
3ffrA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8749 30 264 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A6B3FJM8-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9842 50 203 GO:0004760
GO:0005777
GO:0008453
GO:0019265
AF-A0A2S9FBJ7-F1-model_v4 phosphoserine transaminase (EC 2.6.1.52) (Phosphohydroxythreonine aminotransferase) 0.9831 49 373 GO:0004648
GO:0004760
GO:0005777
GO:0006564
GO:0008453
GO:0008615
GO:0019265
AF-A0A7G1I7M0-F1-model_v4 Aminotransferase class V domain-containing protein 0.9817 99 197
AF-A0A7W1KBB2-F1-model_v4 Phosphoserine transaminase (EC 2.6.1.52) 0.9814 92 372 GO:0004648
GO:0004760
GO:0005777
GO:0006564
GO:0008453
GO:0008615
GO:0019265
AF-A0A6J6HXD8-F1-model_v4 Unannotated protein 0.9792 77 373 GO:0004648
GO:0004760
GO:0005777
GO:0006564
GO:0008453
GO:0019265

Feature Viewer

pLDDT pTM Quality
92.55 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map