F259390

General Info

Members Datasets Scaffolds Average Seq Length
171 98 159 305

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0006261|Ga0495668_0006261_734_1753
Length 339
Sequence MVSTCRKCWNSAISEAQLFIQQAAESMSPEFPTVAVLLAAFNGALWLGEQLDSILAQGGVRVSVFISVDPSTDGTQALCLEYTQRHSNVHLLPSAGPFKGAARNFFRLIRDVDFSTYDYVSFSDQDDIWYPDKLERAVAKLRSGDIQGYSSNVVAFWPDGRRMLIDKAQPQVQWDYLFEAAGPGCTYMLTPALAAQFKDLIITRWNTVQSVALHDWFCYAFARSHGFRWFIDPEPGMDYRQHQSNEVGVNAGFASALRRVRRVFDGWWFSQIAIVSSLAGGDERPGALNSRLIQRAPLRLILNSRQCRRRPRDRLAFAFICLGYSFMGRTLDVDLRREE

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2511231011 Pseudomonas sp. GM30 Isolate Nodule
3 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
4 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
5 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
6 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
7 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
8 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
9 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
12 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
13 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
14 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
15 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
16 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
17 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
18 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
19 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
20 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
21 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
22 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
23 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
24 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
25 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
26 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
30 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
31 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
32 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
33 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
34 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
35 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
36 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
37 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
38 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
39 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
40 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
41 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
42 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
43 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
44 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
45 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
46 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
47 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
48 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
49 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
50 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
51 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
52 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
53 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
54 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
55 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
56 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
57 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
58 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
59 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
60 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
61 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
62 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
63 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
64 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
65 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
66 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
67 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
68 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
69 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
70 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
71 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
72 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
73 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
74 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
75 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
76 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
77 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
78 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
79 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
80 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
81 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
82 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
83 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
84 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
85 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
86 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
87 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
88 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
89 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
90 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
91 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
92 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
93 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
94 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
95 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
96 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
97 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
98 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.98
Metatranscriptomes 0
Isolates 7.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 1.75
Rhizoplane 0.58
Rhizosphere 88.89
Stem 0
Stem Tuber 0
Unclassified 8.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_227 2124908027 Bacteria 12612
2 MRS2a_Contig_237 2124908027 Bacteria 31415
3 Ga0065714_10004087 3300005288 Bacteria 5476
4 Ga0099823_1003015 3300006944 Bacteria 15686
5 Ga0105251_10000893 3300009011 Bacteria 26707
6 Ga0105251_10000986 3300009011 Bacteria 25060
7 Ga0105251_10021098 3300009011 Bacteria 3408
8 Ga0105244_10002422 3300009036 Bacteria 14085
9 Ga0105244_10015723 3300009036 Bacteria 4332
10 Ga0105244_10027982 3300009036 Bacteria 3030
11 Ga0105250_10000476 3300009092 Bacteria 28300
12 Ga0105240_10105306 3300009093 Bacteria 3424
13 Ga0157371_10019996 3300013102 Bacteria 4929
14 Ga0157370_10002807 3300013104 Bacteria 20805
15 Ga0157370_10003397 3300013104 Bacteria 18698
16 Ga0157370_10063041 3300013104 Bacteria 3513
17 Ga0157369_10001287 3300013105 Bacteria 31182
18 Ga0157369_10284599 3300013105 Bacteria 1721
19 Ga0163162_10003212 3300013306 Bacteria 15638
20 Ga0157375_10007922 3300013308 Bacteria 9300
21 Ga0182008_10000895 3300014497 Bacteria 20715
22 Ga0182008_10001504 3300014497 Bacteria 15551
23 Ga0182007_10000396 3300015262 Bacteria 26975
24 Ga0182005_1001439 3300015265 Bacteria 9587
25 Ga0182005_1019996 3300015265 Bacteria 1843
26 Ga0163161_10000631 3300017792 Bacteria 28065
27 Ga0163161_10034084 3300017792 Bacteria 3640
28 Ga0207427_100326 3300025231 Bacteria 32036
29 Ga0207696_1000513 3300025711 Bacteria 32169
30 Ga0207655_1031931 3300025728 Bacteria 2416
31 Ga0207713_1000614 3300025735 Bacteria 35058
32 Ga0207713_1000899 3300025735 Bacteria 26952
33 Ga0207713_1024177 3300025735 Bacteria 2839
34 Ga0209389_1001775 3300027296 Bacteria 15694
35 Ga0265327_10000645 3300031251 Bacteria 56357
36 Ga0307408_100019633 3300031548 Bacteria 4552
37 Ga0307405_10000179 3300031731 Bacteria 23314
38 Ga0307405_10064814 3300031731 Bacteria 2323
39 Ga0307413_10038242 3300031824 Bacteria 2779
40 Ga0307413_10253384 3300031824 Bacteria 1307
41 Ga0307412_10008220 3300031911 Bacteria 5947
42 Ga0307412_10019510 3300031911 Bacteria 4108
43 Ga0307414_10001137 3300032004 Bacteria 13613
44 Ga0307411_10005457 3300032005 Bacteria 6248
45 Ga0395900_0000050 3300037418 Bacteria 224616
46 Ga0439438_000141 3300041405 Bacteria 32709
47 Ga0439438_000272 3300041405 Bacteria 23298
48 Ga0439447_005702 3300041407 Bacteria 4120
49 Ga0439447_011611 3300041407 Bacteria 2562
50 Ga0439432_000427 3300042006 Bacteria 15693
51 Ga0439451_000014 3300042009 Bacteria 42560
52 Ga0439452_000546 3300042010 Bacteria 20013
53 Ga0439456_010521 3300042013 Bacteria 1912
54 Ga0439456_018460 3300042013 Bacteria 1464
55 Ga0495617_000357 3300046452 Bacteria 25206
56 Ga0495617_018216 3300046452 Bacteria 2375
57 Ga0495617_029624 3300046452 Bacteria 1840
58 Ga0495590_0003717 3300046457 Bacteria 6214
59 Ga0495591_000173 3300046458 Bacteria 67156
60 Ga0495591_000449 3300046458 Bacteria 33551
61 Ga0495591_001139 3300046458 Bacteria 17500
62 Ga0495591_004462 3300046458 Bacteria 6849
63 Ga0495638_0000583 3300046460 Bacteria 41251
64 Ga0495653_0001572 3300046463 Bacteria 17883
65 Ga0495605_0000747 3300046474 Bacteria 23843
66 Ga0495605_0005531 3300046474 Bacteria 7353
67 Ga0495584_0000141 3300046491 Bacteria 50024
68 Ga0495584_0000285 3300046491 Bacteria 35720
69 Ga0495584_0138531 3300046491 Bacteria 1235
70 Ga0495585_0000834 3300046492 Bacteria 26612
71 Ga0495607_0000294 3300046501 Bacteria 52746
72 Ga0495583_0000244 3300046506 Bacteria 89766
73 Ga0495606_0000771 3300046507 Bacteria 49120
74 Ga0495606_0008654 3300046507 Bacteria 8785
75 Ga0495610_0001950 3300046512 Bacteria 17740
76 Ga0495610_0004010 3300046512 Bacteria 11112
77 Ga0495616_0000598 3300046513 Bacteria 27217
78 Ga0495616_0014263 3300046513 Bacteria 4456
79 Ga0495616_0109707 3300046513 Bacteria 1283
80 Ga0495620_0006457 3300046515 Bacteria 6442
81 Ga0495620_0049257 3300046515 Bacteria 1804
82 Ga0495632_0000527 3300046519 Bacteria 36131
83 Ga0495632_0003678 3300046519 Bacteria 10761
84 Ga0495632_0005382 3300046519 Bacteria 8470
85 Ga0495637_0000046 3300046520 Bacteria 108118
86 Ga0495637_0000117 3300046520 Bacteria 58356
87 Ga0495637_0000801 3300046520 Bacteria 20905
88 Ga0495637_0000911 3300046520 Bacteria 19000
89 Ga0495637_0003584 3300046520 Bacteria 8230
90 Ga0495637_0038062 3300046520 Bacteria 2084
91 Ga0495637_0097966 3300046520 Bacteria 1149
92 Ga0495643_0001350 3300046522 Bacteria 23094
93 Ga0495643_0012529 3300046522 Bacteria 5113
94 Ga0495644_0005533 3300046523 Bacteria 4932
95 Ga0495648_0001939 3300046524 Bacteria 19708
96 Ga0495648_0004254 3300046524 Bacteria 12281
97 Ga0495648_0009266 3300046524 Bacteria 7652
98 Ga0495648_0011351 3300046524 Bacteria 6714
99 Ga0495666_0000223 3300046526 Bacteria 24132
100 Ga0495642_0000096 3300046528 Bacteria 50386
101 Ga0495654_0000289 3300046530 Bacteria 45610
102 Ga0495654_0000499 3300046530 Bacteria 32120
103 Ga0495654_0073821 3300046530 Bacteria 1612
104 Ga0495609_0000069 3300046538 Bacteria 128601
105 Ga0495609_0000396 3300046538 Bacteria 36617
106 Ga0495597_0010128 3300046542 Bacteria 4618
107 Ga0495597_0095329 3300046542 Bacteria 1259
108 Ga0495622_0001297 3300046557 Bacteria 12811
109 Ga0495668_0006261 3300046616 Bacteria 7844
110 Ga0495611_0029761 3300046648 Bacteria 2396
111 Ga0495661_0000086 3300046665 Bacteria 113945
112 Ga0495671_0000667 3300046692 Bacteria 24862
113 Ga0495649_0000432 3300046694 Bacteria 36223
114 Ga0495649_0001064 3300046694 Bacteria 21463
115 Ga0495649_0001357 3300046694 Bacteria 18631
116 Ga0495649_0002210 3300046694 Bacteria 13889
117 Ga0495589_0017798 3300046794 Bacteria 3645
118 Ga0495589_0045093 3300046794 Bacteria 2190
119 Ga0495660_0000559 3300046810 Bacteria 30477
120 Ga0495660_0001190 3300046810 Bacteria 18276
121 Ga0495660_0010990 3300046810 Bacteria 5258
122 Ga0495660_0057646 3300046810 Bacteria 2095
123 Ga0495636_0000191 3300047318 Bacteria 24040
124 Ga0495672_0001359 3300047320 Bacteria 24241
125 Ga0495680_0002585 3300047322 Bacteria 18426
126 Ga0495679_000106 3300047446 Bacteria 75283
127 Ga0495679_001851 3300047446 Bacteria 11436
128 Ga0495679_002663 3300047446 Bacteria 8944
129 Ga0495673_0001030 3300047469 Bacteria 24579
130 Ga0495673_0005470 3300047469 Bacteria 7671
131 Ga0495681_0000304 3300047470 Bacteria 39427
132 Ga0495681_0000582 3300047470 Bacteria 27894
133 Ga0495681_0000597 3300047470 Bacteria 27535
134 Ga0495681_0002876 3300047470 Bacteria 12170
135 Ga0495626_0000114 3300048091 Bacteria 105174
136 Ga0495626_0000191 3300048091 Bacteria 74236
137 Ga0495626_0000699 3300048091 Bacteria 31942
138 Ga0495626_0000819 3300048091 Bacteria 27987
139 Ga0496102_0035075 3300048905 Bacteria 4515
140 Ga0496117_0002049 3300048920 Bacteria 26674
141 Ga0496118_0002460 3300048921 Bacteria 24906
142 Ga0496121_0001472 3300048924 Bacteria 39643
143 Ga0496121_0002987 3300048924 Bacteria 24569
144 Ga0496122_0023341 3300048925 Bacteria 5457
145 Ga0496123_0019742 3300048926 Bacteria 5300
146 Ga0496123_0061402 3300048926 Bacteria 2415
147 Ga0496124_0012904 3300048927 Bacteria 8199
148 Ga0496125_0035256 3300048928 Bacteria 4394
149 Ga0495678_000192 3300049459 Bacteria 71600
150 Ga0495678_000348 3300049459 Bacteria 48155
151 Ga0495678_000569 3300049459 Bacteria 35204
152 Ga0495678_000928 3300049459 Bacteria 25623
153 Ga0495678_000960 3300049459 Bacteria 24945
154 Ga0495678_001018 3300049459 Bacteria 23928
155 Ga0495678_021436 3300049459 Bacteria 2845
156 Ga0495682_0000077 3300049460 Bacteria 86185
157 Ga0495682_0000651 3300049460 Bacteria 23215
158 Ga0501222_000224 3300049662 Bacteria 9841
159 Ga0501257_002982 3300049686 Bacteria 3599

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 2124908027 MRS2a_Contig_237 MRS2a_00139700 252
2 3300037418 Ga0395900_0000050 Ga0395900_0000050_26609_27493 280
3 3300046452 Ga0495617_029624 Ga0495617_029624_16_939 285
4 3300046519 Ga0495632_0005382 Ga0495632_0005382_6242_7165 285
5 3300046810 Ga0495660_0000559 Ga0495660_0000559_25754_26677 285
6 3300048924 Ga0496121_0001472 Ga0496121_0001472_30532_31443 287
7 3300048926 Ga0496123_0061402 Ga0496123_0061402_471_1382 287
8 3300046542 Ga0495597_0095329 Ga0495597_0095329_360_1232 290
9 3300046794 Ga0495589_0045093 Ga0495589_0045093_1151_2023 290
10 3300046501 Ga0495607_0000294 Ga0495607_0000294_15233_16114 293
11 3300009011 Ga0105251_10000986 Ga0105251_1000098616 294
12 3300009036 Ga0105244_10027982 Ga0105244_100279822 294
13 3300009092 Ga0105250_10000476 Ga0105250_1000047619 294
14 3300013104 Ga0157370_10063041 Ga0157370_100630413 294
15 3300017792 Ga0163161_10034084 Ga0163161_100340844 294
16 3300025711 Ga0207696_1000513 Ga0207696_10005138 294
17 3300025735 Ga0207713_1000899 Ga0207713_10008998 294
18 3300041405 Ga0439438_000141 Ga0439438_000141_5572_6495 294
19 3300048920 Ga0496117_0002049 Ga0496117_0002049_4506_5456 294
20 3300048921 Ga0496118_0002460 Ga0496118_0002460_3732_4682 294
21 3300048924 Ga0496121_0002987 Ga0496121_0002987_20221_21171 294
22 3300048928 Ga0496125_0035256 Ga0496125_0035256_2247_3197 294
23 3300046491 Ga0495584_0000141 Ga0495584_0000141_9510_10454 295
24 3300046665 Ga0495661_0000086 Ga0495661_0000086_59721_60665 295
25 3300046694 Ga0495649_0001064 Ga0495649_0001064_19887_20810 295
26 3300047470 Ga0495681_0000597 Ga0495681_0000597_7685_8629 295
27 3300046492 Ga0495585_0000834 Ga0495585_0000834_3697_4620 296
28 3300046512 Ga0495610_0001950 Ga0495610_0001950_15885_16808 296
29 3300046513 Ga0495616_0109707 Ga0495616_0109707_299_1222 296
30 3300047446 Ga0495679_002663 Ga0495679_002663_4316_5239 296
31 3300049459 Ga0495678_021436 Ga0495678_021436_904_1863 298
32 iso_pu_bacteria 2826581358 2826586682 298
33 iso_pu_bacteria 2842815866 2842820398 298
34 iso_pu_bacteria 2842849001 2842854307 298
35 3300009093 Ga0105240_10105306 Ga0105240_101053062 299
36 3300025231 Ga0207427_100326 Ga0207427_10032621 299
37 3300046513 Ga0495616_0000598 Ga0495616_0000598_22500_23423 299
38 3300046519 Ga0495632_0003678 Ga0495632_0003678_4389_5312 299
39 3300046524 Ga0495648_0001939 Ga0495648_0001939_16101_17024 299
40 3300046530 Ga0495654_0000499 Ga0495654_0000499_26599_27522 299
41 3300046810 Ga0495660_0057646 Ga0495660_0057646_657_1580 299
42 3300048091 Ga0495626_0000819 Ga0495626_0000819_4618_5541 299
43 3300049459 Ga0495678_000928 Ga0495678_000928_20992_21915 299
44 iso_pu_bacteria 8056148874 8056149771 299
45 3300031251 Ga0265327_10000645 Ga0265327_1000064539 300
46 3300046458 Ga0495591_000173 Ga0495591_000173_40027_41010 302
47 3300046506 Ga0495583_0000244 Ga0495583_0000244_23166_24101 302
48 3300046513 Ga0495616_0014263 Ga0495616_0014263_2714_3649 302
49 3300046515 Ga0495620_0006457 Ga0495620_0006457_4828_5763 302
50 3300046520 Ga0495637_0000046 Ga0495637_0000046_77502_78485 302
51 3300046522 Ga0495643_0012529 Ga0495643_0012529_246_1181 302
52 3300046523 Ga0495644_0005533 Ga0495644_0005533_811_1746 302
53 3300046524 Ga0495648_0009266 Ga0495648_0009266_5559_6494 302
54 3300046530 Ga0495654_0000289 Ga0495654_0000289_15441_16376 302
55 3300046538 Ga0495609_0000069 Ga0495609_0000069_44887_45822 302
56 3300046648 Ga0495611_0029761 Ga0495611_0029761_584_1567 302
57 3300046694 Ga0495649_0002210 Ga0495649_0002210_5087_6070 302
58 3300047446 Ga0495679_000106 Ga0495679_000106_42853_43836 302
59 3300048091 Ga0495626_0000114 Ga0495626_0000114_74313_75296 302
60 3300049459 Ga0495678_000348 Ga0495678_000348_15591_16526 302
61 iso_pu_bacteria 2806310737 2807407241 302
62 iso_pu_bacteria 2806310745 2807455570 302
63 3300046458 Ga0495591_001139 Ga0495591_001139_4369_5280 303
64 3300046458 Ga0495591_004462 Ga0495591_004462_5555_6466 303
65 3300046507 Ga0495606_0008654 Ga0495606_0008654_5039_5950 303
66 3300046515 Ga0495620_0049257 Ga0495620_0049257_239_1150 303
67 3300046520 Ga0495637_0000801 Ga0495637_0000801_12716_13627 303
68 3300046524 Ga0495648_0004254 Ga0495648_0004254_697_1608 303
69 3300047469 Ga0495673_0001030 Ga0495673_0001030_11299_12210 303
70 3300049460 Ga0495682_0000077 Ga0495682_0000077_29058_29969 303
71 iso_pu_bacteria 2511231011 2511295203 303
72 iso_pu_bacteria 2718217725 2718635211 303
73 iso_pu_bacteria 3007855910 3007858984 303
74 iso_pu_bacteria 8056166840 8056167254 303
75 iso_pu_bacteria 8056569372 8056572770 303
76 3300006944 Ga0099823_1003015 Ga0099823_10030155 304
77 3300027296 Ga0209389_1001775 Ga0209389_100177511 304
78 3300046452 Ga0495617_000357 Ga0495617_000357_20118_21032 304
79 3300046491 Ga0495584_0138531 Ga0495584_0138531_286_1200 304
80 3300046507 Ga0495606_0000771 Ga0495606_0000771_4558_5472 304
81 3300046512 Ga0495610_0004010 Ga0495610_0004010_4577_5491 304
82 3300046524 Ga0495648_0011351 Ga0495648_0011351_3670_4584 304
83 3300046542 Ga0495597_0010128 Ga0495597_0010128_409_1341 304
84 3300046692 Ga0495671_0000667 Ga0495671_0000667_4341_5255 304
85 3300047470 Ga0495681_0002876 Ga0495681_0002876_3770_4684 304
86 3300048091 Ga0495626_0000191 Ga0495626_0000191_68762_69676 304
87 3300009011 Ga0105251_10000893 Ga0105251_1000089319 305
88 3300009011 Ga0105251_10021098 Ga0105251_100210983 305
89 3300013105 Ga0157369_10284599 Ga0157369_102845991 305
90 3300025735 Ga0207713_1000614 Ga0207713_100061426 305
91 3300025735 Ga0207713_1024177 Ga0207713_10241771 305
92 3300031548 Ga0307408_100019633 Ga0307408_1000196332 305
93 3300031731 Ga0307405_10000179 Ga0307405_1000017920 305
94 3300031824 Ga0307413_10038242 Ga0307413_100382423 305
95 3300031911 Ga0307412_10008220 Ga0307412_100082205 305
96 3300032004 Ga0307414_10001137 Ga0307414_100011376 305
97 3300032005 Ga0307411_10005457 Ga0307411_100054576 305
98 3300046460 Ga0495638_0000583 Ga0495638_0000583_35797_36714 305
99 3300046526 Ga0495666_0000223 Ga0495666_0000223_13009_13926 305
100 3300046810 Ga0495660_0001190 Ga0495660_0001190_12303_13220 305
101 3300047322 Ga0495680_0002585 Ga0495680_0002585_4431_5348 305
102 3300047446 Ga0495679_001851 Ga0495679_001851_1308_2225 305
103 3300047470 Ga0495681_0000304 Ga0495681_0000304_29213_30130 305
104 3300048925 Ga0496122_0023341 Ga0496122_0023341_3421_4338 305
105 3300048926 Ga0496123_0019742 Ga0496123_0019742_2727_3644 305
106 3300048927 Ga0496124_0012904 Ga0496124_0012904_3574_4491 305
107 3300049662 Ga0501222_000224 Ga0501222_000224_4770_5693 305
108 3300049686 Ga0501257_002982 Ga0501257_002982_1696_2619 305
109 3300009036 Ga0105244_10002422 Ga0105244_100024224 306
110 3300013104 Ga0157370_10002807 Ga0157370_100028075 306
111 3300013105 Ga0157369_10001287 Ga0157369_1000128723 306
112 3300014497 Ga0182008_10000895 Ga0182008_1000089517 306
113 3300015265 Ga0182005_1019996 Ga0182005_10199962 306
114 3300046458 Ga0495591_000449 Ga0495591_000449_2605_3570 306
115 3300046520 Ga0495637_0000117 Ga0495637_0000117_23831_24751 306
116 3300046616 Ga0495668_0006261 Ga0495668_0006261_734_1753 306
117 3300046810 Ga0495660_0010990 Ga0495660_0010990_1239_2159 306
118 3300048905 Ga0496102_0035075 Ga0496102_0035075_2848_3867 306
119 3300049459 Ga0495678_000192 Ga0495678_000192_36610_37530 306
120 iso_pu_bacteria 8054929484 8054931348 306
121 2124908027 MRS2a_Contig_227 MRS2a_00129570 307
122 3300005288 Ga0065714_10004087 Ga0065714_100040872 307
123 3300009036 Ga0105244_10015723 Ga0105244_100157235 307
124 3300013102 Ga0157371_10019996 Ga0157371_100199966 307
125 3300013104 Ga0157370_10003397 Ga0157370_1000339714 307
126 3300013306 Ga0163162_10003212 Ga0163162_1000321211 307
127 3300013308 Ga0157375_10007922 Ga0157375_100079223 307
128 3300014497 Ga0182008_10001504 Ga0182008_100015042 307
129 3300015262 Ga0182007_10000396 Ga0182007_1000039626 307
130 3300015265 Ga0182005_1001439 Ga0182005_10014398 307
131 3300017792 Ga0163161_10000631 Ga0163161_100006312 307
132 3300025728 Ga0207655_1031931 Ga0207655_10319312 307
133 3300031731 Ga0307405_10064814 Ga0307405_100648142 307
134 3300031824 Ga0307413_10253384 Ga0307413_102533841 307
135 3300031911 Ga0307412_10019510 Ga0307412_100195103 307
136 3300041405 Ga0439438_000272 Ga0439438_000272_4547_5470 307
137 3300041407 Ga0439447_005702 Ga0439447_005702_1912_2874 307
138 3300041407 Ga0439447_011611 Ga0439447_011611_1201_2145 307
139 3300042006 Ga0439432_000427 Ga0439432_000427_4576_5520 307
140 3300042009 Ga0439451_000014 Ga0439451_000014_38805_39728 307
141 3300042010 Ga0439452_000546 Ga0439452_000546_15381_16304 307
142 3300042013 Ga0439456_010521 Ga0439456_010521_78_1055 307
143 3300042013 Ga0439456_018460 Ga0439456_018460_523_1446 307
144 3300046452 Ga0495617_018216 Ga0495617_018216_326_1249 307
145 3300046457 Ga0495590_0003717 Ga0495590_0003717_644_1567 307
146 3300046463 Ga0495653_0001572 Ga0495653_0001572_3709_4632 307
147 3300046474 Ga0495605_0000747 Ga0495605_0000747_22131_23054 307
148 3300046474 Ga0495605_0005531 Ga0495605_0005531_773_1714 307
149 3300046491 Ga0495584_0000285 Ga0495584_0000285_4705_5628 307
150 3300046519 Ga0495632_0000527 Ga0495632_0000527_4687_5610 307
151 3300046520 Ga0495637_0000911 Ga0495637_0000911_4563_5504 307
152 3300046520 Ga0495637_0003584 Ga0495637_0003584_7178_8101 307
153 3300046520 Ga0495637_0038062 Ga0495637_0038062_319_1242 307
154 3300046520 Ga0495637_0097966 Ga0495637_0097966_78_1001 307
155 3300046522 Ga0495643_0001350 Ga0495643_0001350_49_972 307
156 3300046528 Ga0495642_0000096 Ga0495642_0000096_48790_49713 307
157 3300046530 Ga0495654_0073821 Ga0495654_0073821_118_1041 307
158 3300046538 Ga0495609_0000396 Ga0495609_0000396_4550_5473 307
159 3300046557 Ga0495622_0001297 Ga0495622_0001297_954_1877 307
160 3300046694 Ga0495649_0000432 Ga0495649_0000432_30608_31531 307
161 3300046694 Ga0495649_0001357 Ga0495649_0001357_14029_14952 307
162 3300046794 Ga0495589_0017798 Ga0495589_0017798_350_1273 307
163 3300047318 Ga0495636_0000191 Ga0495636_0000191_681_1604 307
164 3300047320 Ga0495672_0001359 Ga0495672_0001359_882_1805 307
165 3300047469 Ga0495673_0005470 Ga0495673_0005470_3267_4190 307
166 3300047470 Ga0495681_0000582 Ga0495681_0000582_4324_5247 307
167 3300048091 Ga0495626_0000699 Ga0495626_0000699_807_1730 307
168 3300049459 Ga0495678_000569 Ga0495678_000569_3765_4688 307
169 3300049459 Ga0495678_000960 Ga0495678_000960_3670_4593 307
170 3300049459 Ga0495678_001018 Ga0495678_001018_4602_5525 307
171 3300049460 Ga0495682_0000651 Ga0495682_0000651_301_1224 307

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

32

250

0.89

PF00535

Glycos_transf_2

Glycosyl transferase family 2

35

203

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z86-assembly2.cif.gz_D crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-glcua and udp 0.7994 5 252
2z86-assembly1.cif.gz_A crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-glcua and udp 0.7957 5 252
2z87-assembly3.cif.gz_B crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-galnac and udp 0.7941 6 252
2z86-assembly2.cif.gz_C crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-glcua and udp 0.7851 5 252
2z87-assembly2.cif.gz_A crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-galnac and udp 0.778 5 252
ID Description Score Start End Superfamily
af_P71795_2_224_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8074 1 219 3.90.550.10
2z86D01 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7994 5 252 3.90.550.10
af_Q54XQ9_524_764_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7824 4 219 3.90.550.10
af_P71795_2_224_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7744 1 219 3.90.550.10
af_O05154_2_177_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7545 8 169 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A323UT97-F1-model_v4 Glycosyltransferase family 2 protein 0.9786 4 307 GO:0016020
GO:0016740
AF-A0A7V7GNA3-F1-model_v4 Glycosyltransferase 0.9778 18 303 GO:0016740
AF-A0A7V7GNA3-F1-model_v4 Glycosyltransferase 0.9678 18 303 GO:0016740
AF-A0A323UT97-F1-model_v4 Glycosyltransferase family 2 protein 0.9661 4 307 GO:0016020
GO:0016740
AF-A0A1Y6MHN0-F1-model_v4 Putative glycosyl transferase 0.9607 6 307 GO:0016020
GO:0016740

Feature Viewer

pLDDT pTM Quality
90.09 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map