F259218

General Info

Members Datasets Scaffolds Average Seq Length
171 133 342 206

Family's Representative Sequence

Representative Sequence 3300041511|Ga0451855_0597803|Ga0451855_0597803_102_782
Length 226
Sequence MREPSLDIARLWTLALGPGGQQMKLYHNPLSPNVRRVRLTAAVLELPLEEKVLDFSKGEHKNPEYLALNPNGAVPTLVDGDFVLTESRSIMQYLASKRPDSGLLPRDEAQRADVTRWQFWDAAHFSPQLGTLTFEKVLKVMMGLGEPNTVKIEEALSNFRRFAGVLDKRLEGKTYVVGNAVTLADLTLASSLMYAQQTEAPVAEFPNVQAWLSRITTLPAWKKSGS

Samples

Sample ID Description Type Environment
1 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
61 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
62 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
63 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
64 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
67 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
68 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
69 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
70 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
71 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
72 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
73 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
74 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
75 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
79 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
82 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
83 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
84 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
85 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
89 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
90 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
91 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
92 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
93 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
94 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
95 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
96 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
101 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
102 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
103 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
104 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
105 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
106 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
107 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
115 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
116 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
117 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
118 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
121 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
122 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
123 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
124 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
125 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
126 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
127 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
128 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
129 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
130 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
131 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
132 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.68
Nodule 0
Rhizoplane 5.26
Rhizosphere 78.95
Stem 0
Stem Tuber 0
Unclassified 14.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451855_0597803 3300041511 Bacteria 1165
2 rootH2_10096279 3300003320 Unclassified 4084
3 rootH1_10080600 3300003323 Bacteria 6213
4 rootH1_10134075 3300003323 Bacteria 4704
5 Ga0070680_100512246 3300005336 Bacteria 1027
6 Ga0070682_100012878 3300005337 Bacteria 4801
7 Ga0070689_100325304 3300005340 Unclassified 1285
8 Ga0070687_100204641 3300005343 Bacteria 1198
9 Ga0070668_100048372 3300005347 Bacteria 3270
10 Ga0070713_100334389 3300005436 Bacteria 1402
11 Ga0070708_100116853 3300005445 Bacteria 2456
12 Ga0070708_100792074 3300005445 Bacteria 891
13 Ga0070663_100526205 3300005455 Bacteria 985
14 Ga0070685_10145571 3300005466 Bacteria 1496
15 Ga0070706_100019025 3300005467 Bacteria 6336
16 Ga0070706_101079068 3300005467 Unclassified 739
17 Ga0070707_100150425 3300005468 Bacteria 2266
18 Ga0070672_100000415 3300005543 Bacteria 24727
19 Ga0070686_100386804 3300005544 Bacteria 1060
20 Ga0070695_100631535 3300005545 Bacteria 844
21 Ga0070693_100227689 3300005547 Bacteria 1225
22 Ga0070665_100074180 3300005548 Bacteria 3408
23 Ga0068855_100000918 3300005563 Bacteria 36626
24 Ga0068855_100001996 3300005563 Bacteria 25334
25 Ga0068856_100004862 3300005614 Bacteria 13305
26 Ga0068856_100994203 3300005614 Bacteria 857
27 Ga0068852_100608962 3300005616 Unclassified 1097
28 Ga0068864_100173550 3300005618 Bacteria 1967
29 Ga0068861_100000735 3300005719 Bacteria 19603
30 Ga0068861_100250731 3300005719 Bacteria 1510
31 Ga0068858_100762621 3300005842 Unclassified 943
32 Ga0068860_100304411 3300005843 Bacteria 1562
33 Ga0068860_100361030 3300005843 Bacteria 1431
34 Ga0068862_100583906 3300005844 Bacteria 1071
35 Ga0081455_10146875 3300005937 Bacteria 1823
36 Ga0081455_10564642 3300005937 Unclassified 749
37 Ga0075366_10049374 3300006195 Unclassified 2497
38 Ga0068871_100328632 3300006358 Bacteria 1348
39 Ga0075434_100058416 3300006871 Bacteria 3834
40 Ga0099794_10019900 3300007265 Bacteria 3032
41 Ga0111539_10003785 3300009094 Bacteria 19902
42 Ga0111539_11259019 3300009094 Bacteria 859
43 Ga0111539_11547160 3300009094 Unclassified 769
44 Ga0114129_11030645 3300009147 Bacteria 1034
45 Ga0114129_12037516 3300009147 Bacteria 693
46 Ga0105241_10748614 3300009174 Bacteria 896
47 Ga0105248_10553020 3300009177 Bacteria 1298
48 Ga0105249_10515769 3300009553 Bacteria 1242
49 Ga0105246_10136629 3300011119 Bacteria 1838
50 Ga0157370_11006129 3300013104 Unclassified 754
51 Ga0157378_10300423 3300013297 Bacteria 1554
52 Ga0163162_10410723 3300013306 Bacteria 1486
53 Ga0157375_10240943 3300013308 Unclassified 1968
54 Ga0157380_10282656 3300014326 Bacteria 1519
55 Ga0157376_10160244 3300014969 Unclassified 2039
56 Ga0157376_11374139 3300014969 Unclassified 737
57 Ga0213876_10010218 3300021384 Bacteria 5041
58 Ga0207685_10216756 3300025905 Bacteria 908
59 Ga0207654_10454235 3300025911 Unclassified 899
60 Ga0207646_10207224 3300025922 Bacteria 1771
61 Ga0207700_10294291 3300025928 Bacteria 1400
62 Ga0207706_10087557 3300025933 Bacteria 2739
63 Ga0207665_10541204 3300025939 Unclassified 904
64 Ga0207691_10001046 3300025940 Bacteria 27468
65 Ga0207711_10945201 3300025941 Bacteria 801
66 Ga0207667_10000210 3300025949 Bacteria 83248
67 Ga0207667_10022250 3300025949 Bacteria 7006
68 Ga0207668_10248288 3300025972 Bacteria 1444
69 Ga0207702_10030999 3300026078 Bacteria 4456
70 Ga0207675_100000296 3300026118 Bacteria 48019
71 Ga0207675_100280982 3300026118 Bacteria 1617
72 Ga0207428_10041895 3300027907 Bacteria 3705
73 Ga0268264_10352374 3300028381 Bacteria 1401
74 Ga0265326_10005857 3300028558 Bacteria 3857
75 Ga0265319_1000068 3300028563 Bacteria 82808
76 Ga0265319_1148839 3300028563 Bacteria 725
77 Ga0265318_10000040 3300028577 Bacteria 135603
78 Ga0265318_10003210 3300028577 Bacteria 8343
79 Ga0265318_10139062 3300028577 Bacteria 892
80 Ga0307517_10038498 3300028786 Bacteria 5291
81 Ga0307515_10001498 3300028794 Bacteria 52355
82 Ga0265338_10027027 3300028800 Bacteria 5769
83 Ga0265338_10035873 3300028800 Bacteria 4756
84 Ga0265338_10261386 3300028800 Unclassified 1272
85 Ga0265330_10000065 3300031235 Bacteria 91217
86 Ga0265330_10227846 3300031235 Unclassified 786
87 Ga0265332_10001115 3300031238 Bacteria 15670
88 Ga0265328_10009310 3300031239 Bacteria 4005
89 Ga0265328_10103439 3300031239 Bacteria 1056
90 Ga0265320_10000050 3300031240 Bacteria 116002
91 Ga0265325_10000218 3300031241 Bacteria 40418
92 Ga0265325_10049058 3300031241 Bacteria 2181
93 Ga0265329_10000210 3300031242 Bacteria 30518
94 Ga0265340_10002970 3300031247 Bacteria 9652
95 Ga0265340_10003735 3300031247 Bacteria 8569
96 Ga0265340_10031548 3300031247 Bacteria 2649
97 Ga0265339_10003615 3300031249 Bacteria 10791
98 Ga0265331_10000265 3300031250 Bacteria 59480
99 Ga0265327_10000424 3300031251 Bacteria 77145
100 Ga0265316_10000389 3300031344 Bacteria 50152
101 Ga0265316_10001582 3300031344 Bacteria 24347
102 Ga0307513_10002665 3300031456 Bacteria 24613
103 Ga0307509_10000014 3300031507 Bacteria 276789
104 Ga0307509_10066521 3300031507 Bacteria 3781
105 Ga0265313_10000040 3300031595 Bacteria 120713
106 Ga0265313_10000150 3300031595 Bacteria 72956
107 Ga0265314_10000117 3300031711 Bacteria 122918
108 Ga0265314_10100256 3300031711 Bacteria 1863
109 Ga0265342_10000037 3300031712 Bacteria 140873
110 Ga0265342_10081666 3300031712 Bacteria 1866
111 Ga0307516_10008003 3300031730 Bacteria 12030
112 Ga0307516_10044780 3300031730 Bacteria 4375
113 Ga0373932_0036119 3300035112 Unclassified 1401
114 Ga0373941_0121101 3300035115 Bacteria 933
115 Ga0373956_0087858 3300035119 Bacteria 1432
116 Ga0373937_1026185 3300036401 Bacteria 773
117 Ga0436365_0446335 3300039437 Bacteria 22989
118 Ga0451791_1690997 3300041451 Unclassified 1948
119 Ga0451807_0381024 3300041486 Bacteria 1770
120 Ga0451833_0816522 3300041491 Bacteria 2411
121 Ga0451835_0644134 3300041492 Bacteria 1505
122 Ga0451845_0215931 3300041501 Bacteria 1014
123 Ga0451849_1552214 3300041505 Bacteria 1219
124 Ga0451853_0505063 3300041512 Bacteria 925
125 Ga0451853_0744853 3300041512 Bacteria 11840
126 Ga0466972_0145790 3300044658 Bacteria 1114
127 Ga0466972_0345449 3300044658 Bacteria 696
128 Ga0453683_0358559 3300044673 Bacteria 937
129 Ga0451576_0937246 3300045051 Unclassified 908
130 Ga0495629_0037333 3300046459 Bacteria 3425
131 Ga0495651_0258189 3300046462 Bacteria 1187
132 Ga0495643_0131481 3300046522 Bacteria 1256
133 Ga0495649_0135394 3300046694 Bacteria 1299
134 Ga0495589_0066841 3300046794 Bacteria 1760
135 Ga0495604_0065385 3300047317 Bacteria 2769
136 Ga0495680_0101185 3300047322 Unclassified 2147
137 Ga0495680_0160941 3300047322 Unclassified 1630
138 Ga0495675_0389117 3300047444 Bacteria 814
139 Ga0495602_0122946 3300048088 Bacteria 2085
140 Ga0495602_0211042 3300048088 Bacteria 1474
141 Ga0496100_0859441 3300048903 Bacteria 712
142 Ga0496101_0107107 3300048904 Bacteria 2100
143 Ga0496101_0589404 3300048904 Unclassified 879
144 Ga0496104_0983138 3300048907 Bacteria 748
145 Ga0496105_0334979 3300048908 Bacteria 1211
146 Ga0496113_0415187 3300048916 Bacteria 1081
147 Ga0496114_0259783 3300048917 Bacteria 1529
148 Ga0501037_0198862 3300049573 Bacteria 1417
149 Ga0501067_0178679 3300049583 Bacteria 1182
150 Ga0501067_0182799 3300049583 Bacteria 1168
151 Ga0501074_0232910 3300049590 Bacteria 1311
152 Ga0501044_0394564 3300049823 Unclassified 1297
153 nmdc:mga05p37_545496_c1 3300050507 Unclassified 1321
154 nmdc:mga0qj67_859235_c1 3300050509 Bacteria 716
155 nmdc:mga08y16_771_c1 3300050511 Bacteria 30514
156 nmdc:mga0n895_14424_c1 3300050512 Bacteria 7176
157 nmdc:mga0n895_995397_c1 3300050512 Bacteria 820
158 nmdc:mga0rr50_513604_c1 3300050513 Bacteria 1019
159 Ga0495601_0299054 3300053077 Bacteria 1048
160 Ga0495612_0012290 3300053078 Bacteria 3451
161 Ga0495612_0116899 3300053078 Bacteria 1145
162 Ga0500651_0158476 3300053093 Bacteria 1355
163 Ga0500566_0058174 3300053094 Bacteria 2195
164 Ga0500654_181008 3300053099 Unclassified 672
165 Ga0500556_0001645 3300053104 Bacteria 8735
166 Ga0500562_007673 3300053108 Bacteria 2721
167 Ga0500658_0027079 3300053134 Bacteria 2214
168 Ga0500622_0030161 3300053156 Bacteria 2849
169 Ga0501084_0268474 3300054114 Bacteria 1440
170 Ga0587085_040885 3300059506 Bacteria 807
171 Ga0501082_0259903 3300060353 Bacteria 1510
172 Ga0451855_0597803
173 rootH2_10096279
174 rootH1_10080600
175 rootH1_10134075
176 Ga0070680_100512246
177 Ga0070682_100012878
178 Ga0070689_100325304
179 Ga0070687_100204641
180 Ga0070668_100048372
181 Ga0070713_100334389
182 Ga0070708_100116853
183 Ga0070708_100792074
184 Ga0070663_100526205
185 Ga0070685_10145571
186 Ga0070706_100019025
187 Ga0070706_101079068
188 Ga0070707_100150425
189 Ga0070672_100000415
190 Ga0070686_100386804
191 Ga0070695_100631535
192 Ga0070693_100227689
193 Ga0070665_100074180
194 Ga0068855_100000918
195 Ga0068855_100001996
196 Ga0068856_100004862
197 Ga0068856_100994203
198 Ga0068852_100608962
199 Ga0068864_100173550
200 Ga0068861_100000735
201 Ga0068861_100250731
202 Ga0068858_100762621
203 Ga0068860_100304411
204 Ga0068860_100361030
205 Ga0068862_100583906
206 Ga0081455_10146875
207 Ga0081455_10564642
208 Ga0075366_10049374
209 Ga0068871_100328632
210 Ga0075434_100058416
211 Ga0099794_10019900
212 Ga0111539_10003785
213 Ga0111539_11259019
214 Ga0111539_11547160
215 Ga0114129_11030645
216 Ga0114129_12037516
217 Ga0105241_10748614
218 Ga0105248_10553020
219 Ga0105249_10515769
220 Ga0105246_10136629
221 Ga0157370_11006129
222 Ga0157378_10300423
223 Ga0163162_10410723
224 Ga0157375_10240943
225 Ga0157380_10282656
226 Ga0157376_10160244
227 Ga0157376_11374139
228 Ga0213876_10010218
229 Ga0207685_10216756
230 Ga0207654_10454235
231 Ga0207646_10207224
232 Ga0207700_10294291
233 Ga0207706_10087557
234 Ga0207665_10541204
235 Ga0207691_10001046
236 Ga0207711_10945201
237 Ga0207667_10000210
238 Ga0207667_10022250
239 Ga0207668_10248288
240 Ga0207702_10030999
241 Ga0207675_100000296
242 Ga0207675_100280982
243 Ga0207428_10041895
244 Ga0268264_10352374
245 Ga0265326_10005857
246 Ga0265319_1000068
247 Ga0265319_1148839
248 Ga0265318_10000040
249 Ga0265318_10003210
250 Ga0265318_10139062
251 Ga0307517_10038498
252 Ga0307515_10001498
253 Ga0265338_10027027
254 Ga0265338_10035873
255 Ga0265338_10261386
256 Ga0265330_10000065
257 Ga0265330_10227846
258 Ga0265332_10001115
259 Ga0265328_10009310
260 Ga0265328_10103439
261 Ga0265320_10000050
262 Ga0265325_10000218
263 Ga0265325_10049058
264 Ga0265329_10000210
265 Ga0265340_10002970
266 Ga0265340_10003735
267 Ga0265340_10031548
268 Ga0265339_10003615
269 Ga0265331_10000265
270 Ga0265327_10000424
271 Ga0265316_10000389
272 Ga0265316_10001582
273 Ga0307513_10002665
274 Ga0307509_10000014
275 Ga0307509_10066521
276 Ga0265313_10000040
277 Ga0265313_10000150
278 Ga0265314_10000117
279 Ga0265314_10100256
280 Ga0265342_10000037
281 Ga0265342_10081666
282 Ga0307516_10008003
283 Ga0307516_10044780
284 Ga0373932_0036119
285 Ga0373941_0121101
286 Ga0373956_0087858
287 Ga0373937_1026185
288 Ga0436365_0446335
289 Ga0451791_1690997
290 Ga0451807_0381024
291 Ga0451833_0816522
292 Ga0451835_0644134
293 Ga0451845_0215931
294 Ga0451849_1552214
295 Ga0451853_0505063
296 Ga0451853_0744853
297 Ga0466972_0145790
298 Ga0466972_0345449
299 Ga0453683_0358559
300 Ga0451576_0937246
301 Ga0495629_0037333
302 Ga0495651_0258189
303 Ga0495643_0131481
304 Ga0495649_0135394
305 Ga0495589_0066841
306 Ga0495604_0065385
307 Ga0495680_0101185
308 Ga0495680_0160941
309 Ga0495675_0389117
310 Ga0495602_0122946
311 Ga0495602_0211042
312 Ga0496100_0859441
313 Ga0496101_0107107
314 Ga0496101_0589404
315 Ga0496104_0983138
316 Ga0496105_0334979
317 Ga0496113_0415187
318 Ga0496114_0259783
319 Ga0501037_0198862
320 Ga0501067_0178679
321 Ga0501067_0182799
322 Ga0501074_0232910
323 Ga0501044_0394564
324 nmdc:mga05p37_545496_c1
325 nmdc:mga0qj67_859235_c1
326 nmdc:mga08y16_771_c1
327 nmdc:mga0n895_14424_c1
328 nmdc:mga0n895_995397_c1
329 nmdc:mga0rr50_513604_c1
330 Ga0495601_0299054
331 Ga0495612_0012290
332 Ga0495612_0116899
333 Ga0500651_0158476
334 Ga0500566_0058174
335 Ga0500654_181008
336 Ga0500556_0001645
337 Ga0500562_007673
338 Ga0500658_0027079
339 Ga0500622_0030161
340 Ga0501084_0268474
341 Ga0587085_040885
342 Ga0501082_0259903

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

21

96

0.98

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

30

97

0.94

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

150

214

0.94

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

25

102

0.93

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

132

219

0.88

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

133

223

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
8agq-assembly1.cif.gz_A crystal structure of anthocyanin-related gstf8 from populus trichocarpa in complex with (-)-catechin and glutathione 0.9553 2 202
5a4u-assembly1.cif.gz_A atgstf2 from arabidopsis thaliana in complex with indole-3-aldehyde 0.9502 2 202
6tk8-assembly1.cif.gz_AAA-2 gstf1 f122t variant from alopecurus myosuroides 0.947 2 203
7odm-assembly1.cif.gz_AAA-2 amgstf1 y118s variant 0.944 2 203
6ezy-assembly1.cif.gz_A arabidopsis thaliana gstf9, gsh and gsoh bound 0.9408 2 202
ID Description Score Start End Superfamily
af_Q7JVI6_5_81_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9809 3 75 3.40.30.10
af_Q7JVZ8_6_81_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9796 3 75 3.40.30.10
af_Q9VRJ3_29_131_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9784 3 75 3.40.30.10
af_F1R9R0_45_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9704 2 74 3.40.30.10
5zfgB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9687 2 75 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A849Z7N9-F1-model_v4 Glutathione S-transferase family protein 0.9951 1 204 GO:0004364
GO:0006749
AF-A0A536X8Y2-F1-model_v4 Glutathione S-transferase family protein 0.9845 1 202 GO:0016740
AF-A0A7V3HAG9-F1-model_v4 Glutathione S-transferase family protein 0.9839 2 202 GO:0016740
AF-A0A838YDG1-F1-model_v4 Glutathione S-transferase family protein 0.9827 1 204 GO:0004364
GO:0006749
AF-A0A2T4VCQ4-F1-model_v4 Glutathione S-transferase 0.9823 2 204

Map