F257933

General Info

Members Datasets Scaffolds Average Seq Length
171 96 342 147

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10064555|Ga0065714_1006455518
Length 154
Sequence VTQRPAPHTRDLFPVLRPMPTRWADNDSYGHINNVVYYAYFDTVVNTWLMEQGVLLPLEAGAQTIGLVVETQCRYFASAQFPDVLDIGLRVARIGTSSVRYELAVFRSGHNVAAAQGHFVHVYVDNVNRRPVKALPTALRAALVKLESTDAQAT

Samples

Sample ID Description Type Environment
1 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
23 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
33 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
49 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
50 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
51 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
52 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
53 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
54 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
55 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
56 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
57 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
58 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
59 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
60 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
61 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
62 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
63 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
64 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
65 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
66 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
67 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
68 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
69 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
70 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
71 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
72 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
73 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
74 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
75 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
76 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
77 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
89 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
90 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
91 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
92 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
94 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
95 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
96 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.08
Metatranscriptomes 2.92
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.92
Rhizosphere 95.32
Stem 0
Stem Tuber 0
Unclassified 1.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10064555 3300005288 Bacteria 36587
2 rootH1_10031665 3300003323 Bacteria 2152
3 Ga0070658_10007582 3300005327 Bacteria 8756
4 Ga0070660_100250909 3300005339 Bacteria 1443
5 Ga0070659_101189812 3300005366 Bacteria 674
6 Ga0070709_10179667 3300005434 Bacteria 1485
7 Ga0070714_100350715 3300005435 Bacteria 1386
8 Ga0070714_100421087 3300005435 Bacteria 1265
9 Ga0070714_100953314 3300005435 Bacteria 834
10 Ga0070698_100805970 3300005471 Bacteria 883
11 Ga0070679_100044784 3300005530 Bacteria 4408
12 Ga0070684_100661862 3300005535 Bacteria 972
13 Ga0068853_100993649 3300005539 Unclassified 808
14 Ga0070665_101048131 3300005548 Bacteria 827
15 Ga0068855_100048327 3300005563 Bacteria 5022
16 Ga0068855_100085977 3300005563 Bacteria 3638
17 Ga0068855_100707002 3300005563 Bacteria 1078
18 Ga0068857_101390474 3300005577 Bacteria 682
19 Ga0068854_100749167 3300005578 Bacteria 847
20 Ga0068856_100101608 3300005614 Bacteria 2868
21 Ga0068856_100199215 3300005614 Bacteria 2017
22 Ga0081540_1022717 3300005983 Bacteria 3697
23 Ga0105251_10236221 3300009011 Bacteria 823
24 Ga0105240_11618831 3300009093 Bacteria 677
25 Ga0105245_10042545 3300009098 Bacteria 4053
26 Ga0114129_10245054 3300009147 Bacteria 2408
27 Ga0105241_10085675 3300009174 Bacteria 2476
28 Ga0105241_11661267 3300009174 Bacteria 619
29 Ga0105248_11970278 3300009177 Bacteria 663
30 Ga0105237_10079614 3300009545 Bacteria 3267
31 Ga0105237_10588090 3300009545 Bacteria 1120
32 Ga0105237_10942326 3300009545 Bacteria 870
33 Ga0105238_10523057 3300009551 Bacteria 1189
34 Ga0105239_10141528 3300010375 Bacteria 2681
35 Ga0105239_11093996 3300010375 Bacteria 917
36 Ga0105239_12646057 3300010375 Bacteria 585
37 Ga0157370_10330007 3300013104 Bacteria 1407
38 Ga0157369_10006281 3300013105 Bacteria 13796
39 Ga0157369_10542126 3300013105 Bacteria 1203
40 Ga0157374_10541172 3300013296 Bacteria 1172
41 Ga0157372_11790655 3300013307 Bacteria 706
42 Ga0163163_10232855 3300014325 Bacteria 1891
43 Ga0182008_10373128 3300014497 Bacteria 761
44 Ga0197907_10543410 3300020069 Unclassified 851
45 Ga0206356_11772963 3300020070 Bacteria 1190
46 Ga0206354_10358948 3300020081 Bacteria 1232
47 Ga0206353_12017921 3300020082 Bacteria 628
48 Ga0224712_10121716 3300022467 Bacteria 1131
49 Ga0207647_10060256 3300025904 Bacteria 2320
50 Ga0207705_10002044 3300025909 Bacteria 15706
51 Ga0207705_10043097 3300025909 Bacteria 3241
52 Ga0207707_10335885 3300025912 Bacteria 1303
53 Ga0207671_10057122 3300025914 Bacteria 2892
54 Ga0207652_10081299 3300025921 Bacteria 2834
55 Ga0207652_11400116 3300025921 Bacteria 603
56 Ga0207664_10253579 3300025929 Bacteria 1536
57 Ga0207664_10373437 3300025929 Bacteria 1265
58 Ga0207664_11526710 3300025929 Bacteria 590
59 Ga0207665_10205951 3300025939 Bacteria 1435
60 Ga0207667_10049784 3300025949 Bacteria 4423
61 Ga0207667_10128858 3300025949 Bacteria 2606
62 Ga0207639_10289061 3300026041 Bacteria 1445
63 Ga0207702_10090977 3300026078 Bacteria 2671
64 Ga0307406_10679003 3300031901 Bacteria 858
65 Ga0307412_10355673 3300031911 Bacteria 1177
66 Ga0307409_100153437 3300031995 Bacteria 2003
67 Ga0307415_100084108 3300032126 Bacteria 2282
68 Ga0451845_0768459 3300041501 Bacteria 652
69 Ga0451849_0327365 3300041505 Bacteria 566
70 Ga0466969_0020498 3300044656 Bacteria 3423
71 Ga0466969_0059289 3300044656 Bacteria 1861
72 Ga0466972_0053444 3300044658 Bacteria 1945
73 Ga0466972_0128229 3300044658 Bacteria 1195
74 Ga0466972_0275774 3300044658 Bacteria 786
75 Ga0466966_0005034 3300044684 Bacteria 8692
76 Ga0466966_0008445 3300044684 Bacteria 6817
77 Ga0466966_0042867 3300044684 Bacteria 2902
78 Ga0466966_0252863 3300044684 Bacteria 1061
79 Ga0466966_0492760 3300044684 Bacteria 737
80 Ga0466961_0002585 3300044693 Bacteria 11223
81 Ga0466961_0009229 3300044693 Bacteria 6281
82 Ga0466961_0013086 3300044693 Bacteria 5309
83 Ga0466961_0033920 3300044693 Bacteria 3279
84 Ga0466961_0105277 3300044693 Bacteria 1776
85 Ga0466961_0115243 3300044693 Bacteria 1689
86 Ga0466961_0137038 3300044693 Bacteria 1533
87 Ga0466961_0291174 3300044693 Bacteria 998
88 Ga0466961_0389281 3300044693 Bacteria 846
89 Ga0466963_0033467 3300044694 Bacteria 3337
90 Ga0466963_0045267 3300044694 Bacteria 2898
91 Ga0466963_0066641 3300044694 Bacteria 2415
92 Ga0466963_0074383 3300044694 Bacteria 2291
93 Ga0466963_0080820 3300044694 Bacteria 2201
94 Ga0466963_0146149 3300044694 Bacteria 1640
95 Ga0466964_0038044 3300044706 Bacteria 1934
96 Ga0466964_0100550 3300044706 Bacteria 1274
97 Ga0466964_0210204 3300044706 Bacteria 939
98 Ga0466971_0081795 3300044719 Bacteria 1474
99 Ga0466971_0113628 3300044719 Bacteria 1251
100 Ga0466971_0408889 3300044719 Bacteria 662
101 Ga0466968_0018875 3300044735 Bacteria 2770
102 Ga0466968_0250013 3300044735 Bacteria 842
103 Ga0466970_0004517 3300044765 Bacteria 6865
104 Ga0466970_0198201 3300044765 Bacteria 1117
105 Ga0466970_0232003 3300044765 Bacteria 1031
106 Ga0466957_0007692 3300044842 Bacteria 6095
107 Ga0466957_0007953 3300044842 Bacteria 6016
108 Ga0466957_0088996 3300044842 Bacteria 1932
109 Ga0466960_0013297 3300044901 Bacteria 3494
110 Ga0466960_0018438 3300044901 Bacteria 3059
111 Ga0466960_0187991 3300044901 Bacteria 1123
112 Ga0466959_0011935 3300045049 Bacteria 6263
113 Ga0466959_0039184 3300045049 Bacteria 3502
114 Ga0466959_0043084 3300045049 Bacteria 3329
115 Ga0466959_0071349 3300045049 Bacteria 2515
116 Ga0466958_0013806 3300045836 Bacteria 4605
117 Ga0466958_0018724 3300045836 Bacteria 4023
118 Ga0466958_0052254 3300045836 Bacteria 2476
119 Ga0466958_0063313 3300045836 Bacteria 2255
120 Ga0466958_0238036 3300045836 Bacteria 1163
121 Ga0466967_0001479 3300045976 Bacteria 13705
122 Ga0466967_0002568 3300045976 Bacteria 11396
123 Ga0466967_0005137 3300045976 Bacteria 9001
124 Ga0466967_0012485 3300045976 Bacteria 6502
125 Ga0466967_0015088 3300045976 Bacteria 6045
126 Ga0466967_0242586 3300045976 Bacteria 1719
127 Ga0466967_0245690 3300045976 Bacteria 1708
128 Ga0466967_0351849 3300045976 Unclassified 1426
129 Ga0466967_0353591 3300045976 Bacteria 1422
130 Ga0466967_0542206 3300045976 Bacteria 1144
131 Ga0466967_0553712 3300045976 Bacteria 1132
132 Ga0466967_0763985 3300045976 Bacteria 959
133 Ga0495644_0116718 3300046523 Bacteria 1014
134 Ga0495588_0004767 3300046674 Bacteria 5995
135 Ga0495685_166846 3300047447 Bacteria 712
136 Ga0495593_0084558 3300047673 Bacteria 1638
137 Ga0496102_0000814 3300048905 Bacteria 30342
138 Ga0496103_0003576 3300048906 Bacteria 9488
139 Ga0496104_0660024 3300048907 Bacteria 955
140 Ga0496109_1769602 3300048912 Bacteria 551
141 Ga0496112_1205065 3300048915 Bacteria 674
142 Ga0501031_0136562 3300049568 Bacteria 1602
143 Ga0501032_0001905 3300049569 Bacteria 16469
144 Ga0501033_0089018 3300049570 Bacteria 2258
145 Ga0501033_0454721 3300049570 Bacteria 889
146 Ga0501034_0066261 3300049571 Bacteria 3624
147 Ga0501034_0548919 3300049571 Bacteria 1065
148 Ga0501034_0683615 3300049571 Bacteria 926
149 Ga0501036_0144747 3300049572 Bacteria 2005
150 Ga0501037_0074225 3300049573 Bacteria 2472
151 Ga0501038_0060135 3300049574 Bacteria 3252
152 Ga0501038_0398441 3300049574 Bacteria 1065
153 Ga0501039_0283507 3300049575 Bacteria 1302
154 Ga0501043_0054284 3300049579 Bacteria 3146
155 Ga0501047_0026905 3300049581 Bacteria 5538
156 Ga0501047_0094611 3300049581 Bacteria 2866
157 Ga0501047_0406110 3300049581 Bacteria 1195
158 Ga0501048_0000090 3300049582 Bacteria 48441
159 Ga0501070_0007171 3300049586 Bacteria 9468
160 Ga0501070_0474716 3300049586 Bacteria 1007
161 Ga0501074_0438260 3300049590 Bacteria 927
162 Ga0501239_052083 3300049672 Bacteria 595
163 Ga0501080_1477832 3300049742 Bacteria 578
164 Ga0501035_0029484 3300049822 Bacteria 5004
165 Ga0501035_0248384 3300049822 Bacteria 1512
166 Ga0501044_0018440 3300049823 Bacteria 7477
167 Ga0501044_0115961 3300049823 Bacteria 2684
168 nmdc:mga05p37_514642_c1 3300050507 Bacteria 1370
169 nmdc:mga06r32_1707603_c1 3300050510 Bacteria 566
170 Ga0466962_0028677 3300061719 Bacteria 2666
171 Ga0466962_0057403 3300061719 Bacteria 1858
172 Ga0065714_10064555
173 rootH1_10031665
174 Ga0070658_10007582
175 Ga0070660_100250909
176 Ga0070659_101189812
177 Ga0070709_10179667
178 Ga0070714_100350715
179 Ga0070714_100421087
180 Ga0070714_100953314
181 Ga0070698_100805970
182 Ga0070679_100044784
183 Ga0070684_100661862
184 Ga0068853_100993649
185 Ga0070665_101048131
186 Ga0068855_100048327
187 Ga0068855_100085977
188 Ga0068855_100707002
189 Ga0068857_101390474
190 Ga0068854_100749167
191 Ga0068856_100101608
192 Ga0068856_100199215
193 Ga0081540_1022717
194 Ga0105251_10236221
195 Ga0105240_11618831
196 Ga0105245_10042545
197 Ga0114129_10245054
198 Ga0105241_10085675
199 Ga0105241_11661267
200 Ga0105248_11970278
201 Ga0105237_10079614
202 Ga0105237_10588090
203 Ga0105237_10942326
204 Ga0105238_10523057
205 Ga0105239_10141528
206 Ga0105239_11093996
207 Ga0105239_12646057
208 Ga0157370_10330007
209 Ga0157369_10006281
210 Ga0157369_10542126
211 Ga0157374_10541172
212 Ga0157372_11790655
213 Ga0163163_10232855
214 Ga0182008_10373128
215 Ga0197907_10543410
216 Ga0206356_11772963
217 Ga0206354_10358948
218 Ga0206353_12017921
219 Ga0224712_10121716
220 Ga0207647_10060256
221 Ga0207705_10002044
222 Ga0207705_10043097
223 Ga0207707_10335885
224 Ga0207671_10057122
225 Ga0207652_10081299
226 Ga0207652_11400116
227 Ga0207664_10253579
228 Ga0207664_10373437
229 Ga0207664_11526710
230 Ga0207665_10205951
231 Ga0207667_10049784
232 Ga0207667_10128858
233 Ga0207639_10289061
234 Ga0207702_10090977
235 Ga0307406_10679003
236 Ga0307412_10355673
237 Ga0307409_100153437
238 Ga0307415_100084108
239 Ga0451845_0768459
240 Ga0451849_0327365
241 Ga0466969_0020498
242 Ga0466969_0059289
243 Ga0466972_0053444
244 Ga0466972_0128229
245 Ga0466972_0275774
246 Ga0466966_0005034
247 Ga0466966_0008445
248 Ga0466966_0042867
249 Ga0466966_0252863
250 Ga0466966_0492760
251 Ga0466961_0002585
252 Ga0466961_0009229
253 Ga0466961_0013086
254 Ga0466961_0033920
255 Ga0466961_0105277
256 Ga0466961_0115243
257 Ga0466961_0137038
258 Ga0466961_0291174
259 Ga0466961_0389281
260 Ga0466963_0033467
261 Ga0466963_0045267
262 Ga0466963_0066641
263 Ga0466963_0074383
264 Ga0466963_0080820
265 Ga0466963_0146149
266 Ga0466964_0038044
267 Ga0466964_0100550
268 Ga0466964_0210204
269 Ga0466971_0081795
270 Ga0466971_0113628
271 Ga0466971_0408889
272 Ga0466968_0018875
273 Ga0466968_0250013
274 Ga0466970_0004517
275 Ga0466970_0198201
276 Ga0466970_0232003
277 Ga0466957_0007692
278 Ga0466957_0007953
279 Ga0466957_0088996
280 Ga0466960_0013297
281 Ga0466960_0018438
282 Ga0466960_0187991
283 Ga0466959_0011935
284 Ga0466959_0039184
285 Ga0466959_0043084
286 Ga0466959_0071349
287 Ga0466958_0013806
288 Ga0466958_0018724
289 Ga0466958_0052254
290 Ga0466958_0063313
291 Ga0466958_0238036
292 Ga0466967_0001479
293 Ga0466967_0002568
294 Ga0466967_0005137
295 Ga0466967_0012485
296 Ga0466967_0015088
297 Ga0466967_0242586
298 Ga0466967_0245690
299 Ga0466967_0351849
300 Ga0466967_0353591
301 Ga0466967_0542206
302 Ga0466967_0553712
303 Ga0466967_0763985
304 Ga0495644_0116718
305 Ga0495588_0004767
306 Ga0495685_166846
307 Ga0495593_0084558
308 Ga0496102_0000814
309 Ga0496103_0003576
310 Ga0496104_0660024
311 Ga0496109_1769602
312 Ga0496112_1205065
313 Ga0501031_0136562
314 Ga0501032_0001905
315 Ga0501033_0089018
316 Ga0501033_0454721
317 Ga0501034_0066261
318 Ga0501034_0548919
319 Ga0501034_0683615
320 Ga0501036_0144747
321 Ga0501037_0074225
322 Ga0501038_0060135
323 Ga0501038_0398441
324 Ga0501039_0283507
325 Ga0501043_0054284
326 Ga0501047_0026905
327 Ga0501047_0094611
328 Ga0501047_0406110
329 Ga0501048_0000090
330 Ga0501070_0007171
331 Ga0501070_0474716
332 Ga0501074_0438260
333 Ga0501239_052083
334 Ga0501080_1477832
335 Ga0501035_0029484
336 Ga0501035_0248384
337 Ga0501044_0018440
338 Ga0501044_0115961
339 nmdc:mga05p37_514642_c1
340 nmdc:mga06r32_1707603_c1
341 Ga0466962_0028677
342 Ga0466962_0057403

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

29

114

0.97

PF13279

4HBT_2

Thioesterase-like superfamily

21

143

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o6t-assembly3.cif.gz_K crystal structure of the pa5185 protein from pseudomonas aeruginosa strain pao1- orthorhombic form (p2221). 0.9603 9 145
2egi-assembly1.cif.gz_H crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.932 16 121
2o6t-assembly3.cif.gz_K crystal structure of the pa5185 protein from pseudomonas aeruginosa strain pao1- orthorhombic form (p2221). 0.9149 9 145
5dio-assembly1.cif.gz_B-2 crystal structure of unnamed thioesterase lpg2867 from legionella pneumophila, the d21a mutant 0.9132 17 138
3qy3-assembly1.cif.gz_A pa2801 protein, a putative thioesterase from pseudomonas aeruginosa 0.9095 14 141
ID Description Score Start End Superfamily
af_O07408_6_147_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9719 5 143 3.10.129.10
2av9A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9533 10 145 3.10.129.10
af_O07408_6_147_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9453 5 143 3.10.129.10
2egiH00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.932 16 121 3.10.129.10
af_Q9DCP4_49_221_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9202 4 144 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A6V8KXA6-F1-model_v4 Putative acyl-CoA hydrolase/thioesterase 0.9942 4 144 GO:0047617
AF-A0A2W6DR25-F1-model_v4 4-hydroxybenzoyl-CoA thioesterase 0.9912 1 145 GO:0047617
AF-A0A839DTZ5-F1-model_v4 Acyl-CoA thioester hydrolase (EC 3.1.2.-) 0.9871 10 144 GO:0047617
AF-A0A3B7D549-F1-model_v4 4-hydroxybenzoyl-CoA thioesterase 0.9844 8 144 GO:0047617
AF-A0A2W6DR25-F1-model_v4 4-hydroxybenzoyl-CoA thioesterase 0.9844 1 145 GO:0047617

Map