F257587

General Info

Members Datasets Scaffolds Average Seq Length
170 139 340 263

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0297707|Ga0501047_0297707_153_1031
Length 292
Sequence MTDIETLRAAYDEQVRGVPPHPPAGVTHEQDGPLLRIVGQHRGFVTGPRDLGLRGAELDRLIARQRDYFAARGEAVEWKTRGHDLPADLPERLRAAGFVPEEQETVLIGRTAELAVPAAPPEGVTLRQVTADADMHRIAAMESAVWGQDWSWLADDLIGRVAATPDEITVLVAEAAPGTEPGAAETRTGSGPSAAPVLAPDAGPRGEVVCAAWLVHRPGTRFAGLWGGSTLPAWRGRGIYRSLVAARAGLAAARGVEYLQVDASDDSAPILRRLGFHAVTTTTPYVWSPKPA

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
20 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
21 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
22 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
23 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
24 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
25 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
26 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
27 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
35 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
36 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
37 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
38 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
39 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
40 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
41 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
42 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
43 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
44 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
45 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
46 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
47 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
48 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
49 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
50 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
51 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
52 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
53 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
54 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
55 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
56 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
57 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
58 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
59 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
60 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
61 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
62 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
63 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
64 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
65 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
66 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
67 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
68 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
69 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
70 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
71 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
72 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
73 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
74 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
75 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
76 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
77 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
78 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
79 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
80 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
81 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
82 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
83 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
84 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
85 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
86 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
87 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
88 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
89 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
90 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
91 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
92 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
93 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
94 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
95 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
96 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
97 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
98 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
99 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
100 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
101 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
102 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
103 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
104 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
105 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
106 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
107 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
108 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
109 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
110 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
115 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
116 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
119 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
120 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
121 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
122 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
123 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
124 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
125 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
126 2643221647 Streptomyces sp. Root369 Isolate Unclassified
127 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
128 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
129 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
130 2867428634 Streptomyces sp. RP5T Isolate Unclassified
131 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
132 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
133 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
134 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
135 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
136 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
137 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
138 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
139 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.18
Metatranscriptomes 0
Isolates 8.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.71
Nodule 0
Rhizoplane 0.59
Rhizosphere 85.88
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0297707 3300049581 Bacteria 1456
2 rootH2_10037641 3300003320 Bacteria 4352
3 rootH2_10111554 3300003320 Bacteria 3624
4 Ga0070683_100005946 3300005329 Bacteria 10211
5 Ga0070659_100361753 3300005366 Bacteria 1219
6 Ga0070714_100015358 3300005435 Bacteria 6162
7 Ga0070714_100021952 3300005435 Bacteria 5228
8 Ga0070713_100159394 3300005436 Bacteria 2013
9 Ga0070713_100214385 3300005436 Bacteria 1745
10 Ga0070711_100282912 3300005439 Bacteria 1313
11 Ga0070708_100009660 3300005445 Bacteria 7783
12 Ga0070706_100061590 3300005467 Bacteria 3465
13 Ga0070707_100304631 3300005468 Bacteria 1548
14 Ga0070698_100059700 3300005471 Bacteria 3851
15 Ga0070684_100061656 3300005535 Bacteria 3283
16 Ga0068857_100089539 3300005577 Bacteria 2754
17 Ga0068856_100297241 3300005614 Bacteria 1632
18 Ga0070717_10038874 3300006028 Bacteria 3869
19 Ga0070717_10082421 3300006028 Bacteria 2703
20 Ga0075365_10026673 3300006038 Bacteria 3669
21 Ga0070712_100221155 3300006175 Bacteria 1499
22 Ga0075428_100000664 3300006844 Bacteria 35332
23 Ga0105237_10208213 3300009545 Bacteria 1956
24 Ga0105028_108745 3300009993 Bacteria 1059
25 Ga0105239_10084614 3300010375 Bacteria 3494
26 Ga0157372_10291617 3300013307 Bacteria 1897
27 Ga0183367_1002 3300015688 Bacteria 1101531
28 Ga0213876_10059320 3300021384 Bacteria 2020
29 Ga0209758_1001734 3300025297 Bacteria 24285
30 Ga0207426_1017217 3300025302 Bacteria 2574
31 Ga0207646_10005346 3300025922 Bacteria 13524
32 Ga0207700_10020919 3300025928 Bacteria 4455
33 Ga0207700_10198811 3300025928 Bacteria 1688
34 Ga0207664_10008855 3300025929 Bacteria 7041
35 Ga0207690_10301606 3300025932 Bacteria 1254
36 Ga0207661_10002210 3300025944 Bacteria 13428
37 Ga0207674_10028668 3300026116 Bacteria 5873
38 Ga0207674_10152188 3300026116 Bacteria 2270
39 Ga0209371_1007470 3300027312 Bacteria 3802
40 Ga0307515_10108464 3300028794 Bacteria 3271
41 Ga0268256_1018308 3300030500 Bacteria 1947
42 Ga0307511_10067963 3300030521 Bacteria 2637
43 Ga0307508_10003196 3300031616 Bacteria 16749
44 Ga0307411_10071778 3300032005 Bacteria 2348
45 Ga0307507_10117039 3300033179 Bacteria 2150
46 Ga0373926_0094026 3300035083 Bacteria 1117
47 Ga0373923_0048053 3300035111 Bacteria 1780
48 Ga0373936_0020936 3300035113 Bacteria 2542
49 Ga0373924_0061257 3300035410 Bacteria 1574
50 Ga0373935_0005087 3300035692 Bacteria 7748
51 Ga0373937_0264118 3300036401 Bacteria 1623
52 Ga0436365_1099742 3300039437 Bacteria 2136
53 Ga0436363_0431358 3300039450 Bacteria 3033
54 Ga0439448_0000858 3300042005 Bacteria 7416
55 Ga0439455_0016186 3300042012 Bacteria 1722
56 Ga0450902_027317 3300042137 Bacteria 956
57 Ga0450903_000132 3300042138 Bacteria 16352
58 Ga0466966_0102361 3300044684 Bacteria 1770
59 Ga0466961_0023972 3300044693 Bacteria 3926
60 Ga0466963_0625063 3300044694 Bacteria 760
61 Ga0466971_0006311 3300044719 Bacteria 5147
62 Ga0466971_0028387 3300044719 Bacteria 2503
63 Ga0466967_0096955 3300045976 Bacteria 2691
64 Ga0495592_0111207 3300046454 Bacteria 1938
65 Ga0495603_0005168 3300046455 Bacteria 7793
66 Ga0495603_0023994 3300046455 Bacteria 3689
67 Ga0495629_0010373 3300046459 Bacteria 6780
68 Ga0495629_0012587 3300046459 Bacteria 6126
69 Ga0495629_0064001 3300046459 Bacteria 2568
70 Ga0495629_0095817 3300046459 Bacteria 2070
71 Ga0495629_0132020 3300046459 Bacteria 1739
72 Ga0495638_0038257 3300046460 Bacteria 3050
73 Ga0495641_0006261 3300046461 Bacteria 7753
74 Ga0495651_0021430 3300046462 Bacteria 5023
75 Ga0495582_0002570 3300046473 Bacteria 10094
76 Ga0495582_0332820 3300046473 Bacteria 874
77 Ga0495662_0006687 3300046476 Bacteria 5746
78 Ga0495664_0004105 3300046477 Bacteria 7949
79 Ga0495594_0034270 3300046499 Bacteria 2761
80 Ga0495583_0075752 3300046506 Bacteria 1471
81 Ga0495583_0093065 3300046506 Bacteria 1295
82 Ga0495606_0000307 3300046507 Bacteria 84368
83 Ga0495608_0055944 3300046511 Bacteria 2606
84 Ga0495618_0026260 3300046514 Bacteria 3620
85 Ga0495618_0081309 3300046514 Bacteria 2068
86 Ga0495628_0105102 3300046516 Bacteria 2175
87 Ga0495652_0377913 3300046529 Bacteria 1008
88 Ga0495665_0001333 3300046531 Bacteria 13177
89 Ga0495640_0011684 3300046533 Bacteria 6741
90 Ga0495640_0026128 3300046533 Bacteria 4223
91 Ga0495640_0033011 3300046533 Bacteria 3681
92 Ga0495586_0004908 3300046535 Bacteria 7154
93 Ga0495587_0007252 3300046536 Bacteria 7188
94 Ga0495645_0002595 3300046543 Bacteria 12282
95 Ga0495622_0065019 3300046557 Bacteria 1686
96 Ga0495667_0035899 3300046559 Bacteria 3311
97 Ga0495668_0000563 3300046616 Bacteria 45601
98 Ga0495634_0014011 3300046642 Bacteria 5789
99 Ga0495634_0033821 3300046642 Bacteria 3510
100 Ga0495611_0066047 3300046648 Bacteria 1649
101 Ga0495611_0185447 3300046648 Bacteria 972
102 Ga0495625_0000142 3300046660 Bacteria 110278
103 Ga0495625_0055041 3300046660 Bacteria 2839
104 Ga0495625_0128308 3300046660 Bacteria 1719
105 Ga0495635_0325263 3300046663 Bacteria 1028
106 Ga0495588_0000875 3300046674 Bacteria 13323
107 Ga0495588_0100401 3300046674 Bacteria 1520
108 Ga0495657_0010376 3300046675 Bacteria 7012
109 Ga0495657_0056729 3300046675 Bacteria 2606
110 Ga0495599_0034750 3300046678 Bacteria 3165
111 Ga0495623_0027848 3300046679 Bacteria 3637
112 Ga0495646_0088807 3300046680 Bacteria 1789
113 Ga0495613_0015876 3300046689 Bacteria 5607
114 Ga0495613_0133566 3300046689 Bacteria 1776
115 Ga0495624_0013334 3300046690 Bacteria 5606
116 Ga0495670_0127372 3300046691 Bacteria 1326
117 Ga0495671_0048055 3300046692 Bacteria 2130
118 Ga0495649_0244826 3300046694 Bacteria 922
119 Ga0495589_0044195 3300046794 Bacteria 2216
120 Ga0495600_0208916 3300046809 Bacteria 1251
121 Ga0495581_0011940 3300047315 Bacteria 5024
122 Ga0495581_0054186 3300047315 Bacteria 2315
123 Ga0495604_0062286 3300047317 Bacteria 2850
124 Ga0495636_0035306 3300047318 Bacteria 2059
125 Ga0495676_0010271 3300047321 Bacteria 8496
126 Ga0495676_0016852 3300047321 Bacteria 6470
127 Ga0495676_0097712 3300047321 Bacteria 2180
128 Ga0495676_0223542 3300047321 Bacteria 1296
129 Ga0495680_0200538 3300047322 Bacteria 1431
130 Ga0495683_0098459 3300047323 Bacteria 1409
131 Ga0495687_016856 3300047443 Bacteria 3663
132 Ga0495684_0191564 3300047471 Bacteria 1511
133 Ga0495593_0013429 3300047673 Bacteria 4672
134 Ga0495614_0004394 3300048089 Bacteria 6356
135 Ga0495626_0000029 3300048091 Bacteria 202868
136 Ga0496115_0033187 3300048918 Bacteria 4074
137 Ga0496126_0622715 3300048929 Bacteria 848
138 Ga0501033_0076347 3300049570 Bacteria 2460
139 Ga0501034_0060955 3300049571 Bacteria 3790
140 Ga0501034_0206596 3300049571 Bacteria 1920
141 Ga0501036_0081461 3300049572 Bacteria 2735
142 Ga0501043_0053973 3300049579 Bacteria 3156
143 Ga0501077_0166984 3300049593 Bacteria 1398
144 nmdc:mga00v17_10917_c1 3300050491 Bacteria 4977
145 nmdc:mga0yw44_4833_c1 3300050492 Bacteria 6258
146 nmdc:mga0qj67_494830_c1 3300050509 Bacteria 983
147 Ga0495612_0039155 3300053078 Bacteria 1927
148 Ga0495595_0005624 3300053084 Bacteria 5073
149 Ga0495619_0009680 3300053085 Bacteria 6077
150 Ga0500556_0000542 3300053104 Bacteria 25482
151 Ga0500559_0000885 3300053136 Bacteria 19180
152 Ga0500588_0004129 3300053146 Bacteria 3122
153 Ga0466962_0003038 3300061719 Bacteria 8001
154 Ga0466962_0019777 3300061719 Bacteria 3235
155 Ga0466962_0267833 3300061719 Bacteria 841
156 2585308935 2582581313 Bacteria 10042643
157 2644265888 2643221647 Bacteria 10741251
158 2785371399 2784746768 Bacteria 10036182
159 2786672589 2786546132 Bacteria 10419719
160 2816426561 2816332119 Bacteria 8120218
161 2867428649 2867428634 Bacteria 9590268
162 2887482953 2887478801 Bacteria 8972725
163 2954384087 2954380949 Bacteria 10050426
164 2954678864 2954673503 Bacteria 9685905
165 2954685288 2954682443 Bacteria 9862841
166 2954694905 2954691527 Bacteria 10720516
167 2954710082 2954701450 Bacteria 10834262
168 3006398516 3006393351 Bacteria 6615579
169 8001782040 8001781756 Bacteria 9586736
170 8054164637 8054160619 Bacteria 7783213
171 Ga0501047_0297707
172 rootH2_10037641
173 rootH2_10111554
174 Ga0070683_100005946
175 Ga0070659_100361753
176 Ga0070714_100015358
177 Ga0070714_100021952
178 Ga0070713_100159394
179 Ga0070713_100214385
180 Ga0070711_100282912
181 Ga0070708_100009660
182 Ga0070706_100061590
183 Ga0070707_100304631
184 Ga0070698_100059700
185 Ga0070684_100061656
186 Ga0068857_100089539
187 Ga0068856_100297241
188 Ga0070717_10038874
189 Ga0070717_10082421
190 Ga0075365_10026673
191 Ga0070712_100221155
192 Ga0075428_100000664
193 Ga0105237_10208213
194 Ga0105028_108745
195 Ga0105239_10084614
196 Ga0157372_10291617
197 Ga0183367_1002
198 Ga0213876_10059320
199 Ga0209758_1001734
200 Ga0207426_1017217
201 Ga0207646_10005346
202 Ga0207700_10020919
203 Ga0207700_10198811
204 Ga0207664_10008855
205 Ga0207690_10301606
206 Ga0207661_10002210
207 Ga0207674_10028668
208 Ga0207674_10152188
209 Ga0209371_1007470
210 Ga0307515_10108464
211 Ga0268256_1018308
212 Ga0307511_10067963
213 Ga0307508_10003196
214 Ga0307411_10071778
215 Ga0307507_10117039
216 Ga0373926_0094026
217 Ga0373923_0048053
218 Ga0373936_0020936
219 Ga0373924_0061257
220 Ga0373935_0005087
221 Ga0373937_0264118
222 Ga0436365_1099742
223 Ga0436363_0431358
224 Ga0439448_0000858
225 Ga0439455_0016186
226 Ga0450902_027317
227 Ga0450903_000132
228 Ga0466966_0102361
229 Ga0466961_0023972
230 Ga0466963_0625063
231 Ga0466971_0006311
232 Ga0466971_0028387
233 Ga0466967_0096955
234 Ga0495592_0111207
235 Ga0495603_0005168
236 Ga0495603_0023994
237 Ga0495629_0010373
238 Ga0495629_0012587
239 Ga0495629_0064001
240 Ga0495629_0095817
241 Ga0495629_0132020
242 Ga0495638_0038257
243 Ga0495641_0006261
244 Ga0495651_0021430
245 Ga0495582_0002570
246 Ga0495582_0332820
247 Ga0495662_0006687
248 Ga0495664_0004105
249 Ga0495594_0034270
250 Ga0495583_0075752
251 Ga0495583_0093065
252 Ga0495606_0000307
253 Ga0495608_0055944
254 Ga0495618_0026260
255 Ga0495618_0081309
256 Ga0495628_0105102
257 Ga0495652_0377913
258 Ga0495665_0001333
259 Ga0495640_0011684
260 Ga0495640_0026128
261 Ga0495640_0033011
262 Ga0495586_0004908
263 Ga0495587_0007252
264 Ga0495645_0002595
265 Ga0495622_0065019
266 Ga0495667_0035899
267 Ga0495668_0000563
268 Ga0495634_0014011
269 Ga0495634_0033821
270 Ga0495611_0066047
271 Ga0495611_0185447
272 Ga0495625_0000142
273 Ga0495625_0055041
274 Ga0495625_0128308
275 Ga0495635_0325263
276 Ga0495588_0000875
277 Ga0495588_0100401
278 Ga0495657_0010376
279 Ga0495657_0056729
280 Ga0495599_0034750
281 Ga0495623_0027848
282 Ga0495646_0088807
283 Ga0495613_0015876
284 Ga0495613_0133566
285 Ga0495624_0013334
286 Ga0495670_0127372
287 Ga0495671_0048055
288 Ga0495649_0244826
289 Ga0495589_0044195
290 Ga0495600_0208916
291 Ga0495581_0011940
292 Ga0495581_0054186
293 Ga0495604_0062286
294 Ga0495636_0035306
295 Ga0495676_0010271
296 Ga0495676_0016852
297 Ga0495676_0097712
298 Ga0495676_0223542
299 Ga0495680_0200538
300 Ga0495683_0098459
301 Ga0495687_016856
302 Ga0495684_0191564
303 Ga0495593_0013429
304 Ga0495614_0004394
305 Ga0495626_0000029
306 Ga0496115_0033187
307 Ga0496126_0622715
308 Ga0501033_0076347
309 Ga0501034_0060955
310 Ga0501034_0206596
311 Ga0501036_0081461
312 Ga0501043_0053973
313 Ga0501077_0166984
314 nmdc:mga00v17_10917_c1
315 nmdc:mga0yw44_4833_c1
316 nmdc:mga0qj67_494830_c1
317 Ga0495612_0039155
318 Ga0495595_0005624
319 Ga0495619_0009680
320 Ga0500556_0000542
321 Ga0500559_0000885
322 Ga0500588_0004129
323 Ga0466962_0003038
324 Ga0466962_0019777
325 Ga0466962_0267833
326 2585308935
327 2644265888
328 2785371399
329 2786672589
330 2816426561
331 2867428649
332 2887482953
333 2954384087
334 2954678864
335 2954685288
336 2954694905
337 2954710082
338 3006398516
339 8001782040
340 8054164637

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hmn-assembly1.cif.gz_C crystal structure of an aminoglycoside acetyltransferase hmb0005 from an uncultured soil metagenomic sample, unknown active site density modeled as polyethylene glycol 0.8475 127 249
5c82-assembly1.cif.gz_A-2 crystal structure of nourseothricin acetyltransferase 0.8288 168 262
3mgd-assembly1.cif.gz_A-2 crystal structure of predicted acetyltransferase with acetyl-coa from clostridium acetobutylicum at the resolution 1.9a, northeast structural genomics consortium target car165 0.8197 127 251
6bvc-assembly1.cif.gz_A-2 crystal structure of aac(3)-ia in complex with coenzyme a 0.8122 127 247
3e0k-assembly1.cif.gz_A-2 crystal structure of c-termianl domain of n-acetylglutamate synthase from vibrio parahaemolyticus 0.8114 127 253
ID Description Score Start End Superfamily
af_O13738_1_94_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8939 169 249 3.40.630.30
af_Q09518_10_141_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8651 179 251 3.40.630.30
af_A0A286YBP0_57_178_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8586 156 251 3.40.630.30
af_O64737_28_157_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8535 171 252 3.40.630.30
5hmnC00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8475 127 249 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A4R2Q035-F1-model_v4 deleted 0.9894 32 266
AF-A0A7W0W447-F1-model_v4 GNAT family N-acetyltransferase 0.9775 158 251 GO:0016747
AF-A0A327UWA6-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9751 7 266 GO:0016747
AF-A0A7W7C165-F1-model_v4 deleted 0.9686 2 266
AF-A0A4R2Q035-F1-model_v4 deleted 0.9648 32 266

Map