F257015

General Info

Members Datasets Scaffolds Average Seq Length
170 137 340 124

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10211951|Ga0307515_102119511
Length 149
Sequence MSKSASPLTVIDPDEGVPCCPPMAQTRVPAEAAAVLSLAFKALGDPIRLQLMSMIASAPGGEVCVCDLTPAFDLTGPTISHHLKVLREAGLVDAERRASWVYYRARPVLMRQLAALLAVDDPTTVDPSQIAGTEVLATMVGGSRRPAQE

Samples

Sample ID Description Type Environment
1 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
74 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
75 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
76 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
77 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
86 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
87 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
88 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
89 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
90 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
91 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
92 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
93 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
94 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
95 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
96 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
97 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
98 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
99 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
100 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
101 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
102 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
103 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
104 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
105 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
106 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
107 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
108 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
109 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
110 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
111 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
112 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
113 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
114 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
115 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
116 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
117 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
118 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
119 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
120 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
121 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
122 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
123 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
124 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
125 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
126 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
127 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
128 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
129 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
130 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
131 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
132 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
133 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
134 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
135 649633069 Micromonospora sp. L5 Isolate Unclassified
136 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
137 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.47
Metatranscriptomes 0.59
Isolates 12.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.18
Nodule 0.59
Rhizoplane 1.76
Rhizosphere 65.29
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307515_10211951 3300028794 Bacteria 1779
2 Ga0070683_100002557 3300005329 Bacteria 14539
3 Ga0068869_100022834 3300005334 Bacteria 4314
4 Ga0068868_100004256 3300005338 Bacteria 10016
5 Ga0070660_100115144 3300005339 Bacteria 2143
6 Ga0070661_100010057 3300005344 Bacteria 6567
7 Ga0070692_10003629 3300005345 Bacteria 6303
8 Ga0070668_100014607 3300005347 Bacteria 5870
9 Ga0070669_100204266 3300005353 Bacteria 1556
10 Ga0070675_100023493 3300005354 Bacteria 4931
11 Ga0070673_100345529 3300005364 Bacteria 1319
12 Ga0070713_100325285 3300005436 Bacteria 1421
13 Ga0070701_10277061 3300005438 Bacteria 1023
14 Ga0070700_100068478 3300005441 Bacteria 2257
15 Ga0070663_100020674 3300005455 Bacteria 4361
16 Ga0070662_100013034 3300005457 Bacteria 5526
17 Ga0068867_100055929 3300005459 Bacteria 2918
18 Ga0070685_10246668 3300005466 Bacteria 1181
19 Ga0070706_100933967 3300005467 Bacteria 801
20 Ga0070679_101035152 3300005530 Bacteria 765
21 Ga0070684_100019846 3300005535 Bacteria 5569
22 Ga0070684_100026623 3300005535 Bacteria 4873
23 Ga0070665_100065319 3300005548 Bacteria 3650
24 Ga0068855_102026249 3300005563 Bacteria 581
25 Ga0070664_100001185 3300005564 Bacteria 20756
26 Ga0068857_100052570 3300005577 Bacteria 3614
27 Ga0068854_100583745 3300005578 Bacteria 952
28 Ga0068856_101110629 3300005614 Bacteria 808
29 Ga0070702_100070539 3300005615 Bacteria 2063
30 Ga0068852_100008057 3300005616 Bacteria 7728
31 Ga0068864_100161158 3300005618 Bacteria 2039
32 Ga0068861_100312329 3300005719 Bacteria 1366
33 Ga0068858_101019418 3300005842 Bacteria 811
34 Ga0068860_100341259 3300005843 Bacteria 1473
35 Ga0068860_100712141 3300005843 Bacteria 1014
36 Ga0068862_100105793 3300005844 Bacteria 2466
37 Ga0068862_100259950 3300005844 Bacteria 1585
38 Ga0068865_100255822 3300006881 Bacteria 1384
39 Ga0111539_10006924 3300009094 Bacteria 14552
40 Ga0105245_10012392 3300009098 Bacteria 7420
41 Ga0105247_11406072 3300009101 Bacteria 565
42 Ga0105237_11137779 3300009545 Bacteria 787
43 Ga0105238_11112940 3300009551 Bacteria 813
44 Ga0105239_10886781 3300010375 Bacteria 1024
45 Ga0157374_11230830 3300013296 Bacteria 770
46 Ga0163162_11078414 3300013306 Bacteria 910
47 Ga0157377_10013431 3300014745 Bacteria 4145
48 Ga0206354_10578036 3300020081 Bacteria 1157
49 Ga0207688_10072357 3300025901 Bacteria 1958
50 Ga0207663_10102898 3300025916 Bacteria 1922
51 Ga0207657_10072768 3300025919 Bacteria 2906
52 Ga0207652_11274728 3300025921 Bacteria 637
53 Ga0207694_10789735 3300025924 Bacteria 802
54 Ga0207659_10002478 3300025926 Bacteria 11001
55 Ga0207687_10030435 3300025927 Bacteria 3640
56 Ga0207664_10236635 3300025929 Bacteria 1589
57 Ga0207706_10007095 3300025933 Bacteria 10365
58 Ga0207704_10209141 3300025938 Bacteria 1434
59 Ga0207689_10011315 3300025942 Bacteria 7655
60 Ga0207661_10016740 3300025944 Bacteria 5412
61 Ga0207679_10021569 3300025945 Bacteria 4370
62 Ga0207679_10540694 3300025945 Bacteria 1044
63 Ga0207668_10018859 3300025972 Bacteria 4348
64 Ga0207677_10006013 3300026023 Bacteria 6614
65 Ga0207703_10678270 3300026035 Bacteria 979
66 Ga0207678_10026779 3300026067 Bacteria 5029
67 Ga0207708_10098964 3300026075 Bacteria 2255
68 Ga0207702_10747060 3300026078 Bacteria 966
69 Ga0207648_10123112 3300026089 Bacteria 2281
70 Ga0207676_10050573 3300026095 Bacteria 3241
71 Ga0207674_10037972 3300026116 Bacteria 5003
72 Ga0207675_100033593 3300026118 Bacteria 4779
73 Ga0207698_10069291 3300026142 Bacteria 2789
74 Ga0207428_10041125 3300027907 Bacteria 3744
75 Ga0268265_10025992 3300028380 Bacteria 4162
76 Ga0268264_11377170 3300028381 Bacteria 716
77 Ga0307515_10002222 3300028794 Bacteria 42600
78 Ga0307515_10012837 3300028794 Bacteria 15720
79 Ga0307515_10026760 3300028794 Bacteria 9904
80 Ga0307512_10004254 3300030522 Bacteria 15812
81 Ga0307512_10015741 3300030522 Bacteria 6999
82 Ga0307513_10004690 3300031456 Bacteria 18180
83 Ga0307513_10035499 3300031456 Bacteria 5576
84 Ga0307513_10122718 3300031456 Bacteria 2561
85 Ga0307513_10208517 3300031456 Bacteria 1788
86 Ga0307513_10544012 3300031456 Bacteria 874
87 Ga0307508_10188688 3300031616 Bacteria 1662
88 Ga0307514_10264763 3300031649 Bacteria 1002
89 Ga0307516_10008204 3300031730 Bacteria 11860
90 Ga0307516_10008925 3300031730 Bacteria 11247
91 Ga0307516_10015548 3300031730 Bacteria 8004
92 Ga0307516_10040915 3300031730 Bacteria 4609
93 Ga0307516_10101857 3300031730 Bacteria 2687
94 Ga0307516_10953854 3300031730 Bacteria 527
95 Ga0307405_10162702 3300031731 Bacteria 1583
96 Ga0307413_10772008 3300031824 Bacteria 805
97 Ga0307406_10148272 3300031901 Bacteria 1670
98 Ga0307406_10494981 3300031901 Bacteria 990
99 Ga0307407_10205110 3300031903 Bacteria 1324
100 Ga0307407_10507694 3300031903 Bacteria 885
101 Ga0307407_10521398 3300031903 Bacteria 874
102 Ga0307409_100374586 3300031995 Bacteria 1351
103 Ga0307416_100899770 3300032002 Bacteria 985
104 Ga0307416_100912069 3300032002 Bacteria 979
105 Ga0307415_100087122 3300032126 Bacteria 2249
106 Ga0307415_100253588 3300032126 Bacteria 1431
107 Ga0307415_100327200 3300032126 Bacteria 1281
108 Ga0307415_101139755 3300032126 Bacteria 732
109 Ga0307507_10000009 3300033179 Bacteria 265992
110 Ga0373939_0525465 3300035114 Bacteria 508
111 Ga0373941_0145527 3300035115 Bacteria 865
112 Ga0373942_0002419 3300035207 Bacteria 4535
113 Ga0373942_0024616 3300035207 Bacteria 1545
114 Ga0373962_0076243 3300035242 Bacteria 1010
115 Ga0451791_1924784 3300041451 Bacteria 1029
116 Ga0451793_0088359 3300041452 Bacteria 542
117 Ga0451837_1857249 3300041494 Bacteria 1120
118 Ga0451849_0331402 3300041505 Bacteria 627
119 Ga0451853_1195617 3300041512 Bacteria 3624
120 Ga0451853_2713901 3300041512 Bacteria 759
121 Ga0451853_2778972 3300041512 Bacteria 1321
122 Ga0495594_0119540 3300046499 Bacteria 1489
123 Ga0495628_0029096 3300046516 Bacteria 4484
124 Ga0495628_0083140 3300046516 Bacteria 2486
125 Ga0495632_0008726 3300046519 Bacteria 6181
126 Ga0495622_0226559 3300046557 Bacteria 827
127 Ga0496113_1597930 3300048916 Bacteria 502
128 nmdc:mga08y16_14025_c1 3300050511 Bacteria 8435
129 Ga0495601_0002330 3300053077 Bacteria 10745
130 Ga0500646_0001039 3300053090 Bacteria 7586
131 Ga0500583_0015738 3300053092 Bacteria 3002
132 Ga0500583_0159637 3300053092 Bacteria 1123
133 Ga0500651_0518339 3300053093 Bacteria 655
134 Ga0500641_0168040 3300053096 Bacteria 944
135 Ga0500641_0280152 3300053096 Bacteria 691
136 Ga0500650_0093434 3300053098 Bacteria 1408
137 Ga0500650_0306006 3300053098 Bacteria 703
138 Ga0500556_0072653 3300053104 Bacteria 1288
139 Ga0500569_086984 3300053109 Bacteria 1007
140 Ga0500594_0037788 3300053118 Bacteria 1305
141 Ga0500652_039360 3300053131 Bacteria 1895
142 Ga0500577_0111923 3300053142 Bacteria 1128
143 Ga0500579_158589 3300053143 Bacteria 962
144 Ga0500588_0019576 3300053146 Bacteria 1802
145 Ga0500600_0106971 3300053149 Bacteria 1465
146 Ga0500600_0320061 3300053149 Bacteria 654
147 Ga0500630_067892 3300053159 Bacteria 1692
148 Ga0500633_0354570 3300053160 Bacteria 534
149 2515497023 2515154088 Bacteria 5526283
150 2515720086 2515154129 Bacteria 5584369
151 2515758826 2515154137 Bacteria 5711575
152 2516084870 2515154202 Bacteria 5471270
153 2516088284 2515154203 Bacteria 5458536
154 2623589320 2622736626 Bacteria 7181580
155 2623590086 2622736626 Bacteria 7181580
156 2676484739 2675903059 Bacteria 8644972
157 2753265937 2751185782 Bacteria 11227053
158 2855677524 2855676851 Bacteria 7063653
159 2856863476 2856858025 Bacteria 7255264
160 2858853367 2858848962 Bacteria 6963058
161 2858891415 2858888857 Bacteria 7060307
162 2858901544 2858895516 Bacteria 7378898
163 2867308947 2867302475 Bacteria 7087181
164 2869053992 2869048445 Bacteria 6875584
165 2880493845 2880489317 Bacteria 7096270
166 2880502399 2880495981 Bacteria 7340502
167 2996225313 2996221748 Bacteria 6799777
168 649814759 649633069 Bacteria 6962533
169 8003871956 8003870546 Bacteria 7396674
170 8055416872 8055412473 Bacteria 6257500
171 Ga0307515_10211951
172 Ga0070683_100002557
173 Ga0068869_100022834
174 Ga0068868_100004256
175 Ga0070660_100115144
176 Ga0070661_100010057
177 Ga0070692_10003629
178 Ga0070668_100014607
179 Ga0070669_100204266
180 Ga0070675_100023493
181 Ga0070673_100345529
182 Ga0070713_100325285
183 Ga0070701_10277061
184 Ga0070700_100068478
185 Ga0070663_100020674
186 Ga0070662_100013034
187 Ga0068867_100055929
188 Ga0070685_10246668
189 Ga0070706_100933967
190 Ga0070679_101035152
191 Ga0070684_100019846
192 Ga0070684_100026623
193 Ga0070665_100065319
194 Ga0068855_102026249
195 Ga0070664_100001185
196 Ga0068857_100052570
197 Ga0068854_100583745
198 Ga0068856_101110629
199 Ga0070702_100070539
200 Ga0068852_100008057
201 Ga0068864_100161158
202 Ga0068861_100312329
203 Ga0068858_101019418
204 Ga0068860_100341259
205 Ga0068860_100712141
206 Ga0068862_100105793
207 Ga0068862_100259950
208 Ga0068865_100255822
209 Ga0111539_10006924
210 Ga0105245_10012392
211 Ga0105247_11406072
212 Ga0105237_11137779
213 Ga0105238_11112940
214 Ga0105239_10886781
215 Ga0157374_11230830
216 Ga0163162_11078414
217 Ga0157377_10013431
218 Ga0206354_10578036
219 Ga0207688_10072357
220 Ga0207663_10102898
221 Ga0207657_10072768
222 Ga0207652_11274728
223 Ga0207694_10789735
224 Ga0207659_10002478
225 Ga0207687_10030435
226 Ga0207664_10236635
227 Ga0207706_10007095
228 Ga0207704_10209141
229 Ga0207689_10011315
230 Ga0207661_10016740
231 Ga0207679_10021569
232 Ga0207679_10540694
233 Ga0207668_10018859
234 Ga0207677_10006013
235 Ga0207703_10678270
236 Ga0207678_10026779
237 Ga0207708_10098964
238 Ga0207702_10747060
239 Ga0207648_10123112
240 Ga0207676_10050573
241 Ga0207674_10037972
242 Ga0207675_100033593
243 Ga0207698_10069291
244 Ga0207428_10041125
245 Ga0268265_10025992
246 Ga0268264_11377170
247 Ga0307515_10002222
248 Ga0307515_10012837
249 Ga0307515_10026760
250 Ga0307512_10004254
251 Ga0307512_10015741
252 Ga0307513_10004690
253 Ga0307513_10035499
254 Ga0307513_10122718
255 Ga0307513_10208517
256 Ga0307513_10544012
257 Ga0307508_10188688
258 Ga0307514_10264763
259 Ga0307516_10008204
260 Ga0307516_10008925
261 Ga0307516_10015548
262 Ga0307516_10040915
263 Ga0307516_10101857
264 Ga0307516_10953854
265 Ga0307405_10162702
266 Ga0307413_10772008
267 Ga0307406_10148272
268 Ga0307406_10494981
269 Ga0307407_10205110
270 Ga0307407_10507694
271 Ga0307407_10521398
272 Ga0307409_100374586
273 Ga0307416_100899770
274 Ga0307416_100912069
275 Ga0307415_100087122
276 Ga0307415_100253588
277 Ga0307415_100327200
278 Ga0307415_101139755
279 Ga0307507_10000009
280 Ga0373939_0525465
281 Ga0373941_0145527
282 Ga0373942_0002419
283 Ga0373942_0024616
284 Ga0373962_0076243
285 Ga0451791_1924784
286 Ga0451793_0088359
287 Ga0451837_1857249
288 Ga0451849_0331402
289 Ga0451853_1195617
290 Ga0451853_2713901
291 Ga0451853_2778972
292 Ga0495594_0119540
293 Ga0495628_0029096
294 Ga0495628_0083140
295 Ga0495632_0008726
296 Ga0495622_0226559
297 Ga0496113_1597930
298 nmdc:mga08y16_14025_c1
299 Ga0495601_0002330
300 Ga0500646_0001039
301 Ga0500583_0015738
302 Ga0500583_0159637
303 Ga0500651_0518339
304 Ga0500641_0168040
305 Ga0500641_0280152
306 Ga0500650_0093434
307 Ga0500650_0306006
308 Ga0500556_0072653
309 Ga0500569_086984
310 Ga0500594_0037788
311 Ga0500652_039360
312 Ga0500577_0111923
313 Ga0500579_158589
314 Ga0500588_0019576
315 Ga0500600_0106971
316 Ga0500600_0320061
317 Ga0500630_067892
318 Ga0500633_0354570
319 2515497023
320 2515720086
321 2515758826
322 2516084870
323 2516088284
324 2623589320
325 2623590086
326 2676484739
327 2753265937
328 2855677524
329 2856863476
330 2858853367
331 2858891415
332 2858901544
333 2867308947
334 2869053992
335 2880493845
336 2880502399
337 2996225313
338 649814759
339 8003871956
340 8055416872

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

45

94

0.98

PF12840

HTH_20

Helix-turn-helix domain

43

95

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.8758 39 121
3f6v-assembly1.cif.gz_A-2 crystal structure of possible transcriptional regulator for arsenical resistance 0.8534 39 120
2oqg-assembly1.cif.gz_B arsr-like transcriptional regulator from rhodococcus sp. rha1 0.8528 32 121
7txo-assembly1.cif.gz_A selenomethionine labeled structure of rext 0.8494 40 117
2oqg-assembly1.cif.gz_D arsr-like transcriptional regulator from rhodococcus sp. rha1 0.8447 38 121
ID Description Score Start End Superfamily
af_Q4DZU8_467_618_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.9353 84 109 3.30.230.130
af_O53478_1_106_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.883 41 121 1.10.10.10
3f6oB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8758 39 121 1.10.10.10
af_O53773_1_99_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8741 44 121 1.10.10.10
af_P71941_17_120_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.862 26 127 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6N9Y1L7-F1-model_v4 deleted 0.943 48 123
AF-G4HTW6-F1-model_v4 deleted 0.941 44 125
AF-A0A7I7WNG3-F1-model_v4 HTH arsR-type domain-containing protein 0.9396 41 125 GO:0003700
GO:0046685
AF-A0A1G7W2Q1-F1-model_v4 ArsR family transcriptional regulator 0.936 41 121 GO:0003700
AF-A0A853BEL4-F1-model_v4 ArsR family transcriptional regulator 0.9354 44 127 GO:0003700
GO:0046685

Map