F256881

General Info

Members Datasets Scaffolds Average Seq Length
170 112 170 233

Family's Representative Sequence

Representative Sequence 3300025907|Ga0207645_10118571|Ga0207645_101185712
Length 258
Sequence MPKNAFSLELVDNPKDTYTVEATDAAGKVVYKTAFSPKTVEREYLDKFGRPLIIFPTSGGRYFENEDFKLTASLADKVDRGEIQLVCVDSVDNESWYNKSVHPAVRAARHAQYDAYLRHEMVPYIFNRAQRGDLAVYGASFGAYHAADFASRHPDVVSRAICFSGVYDIHPFLDGYWDETCYFHCPTANIPNMDGEWTGKLARIDWIIATGEYDTLVQKNRDFSQMLWNKGIPNLLEIWPGQFGHDWPWWREHLRRFV

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
94 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
95 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
96 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
97 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
100 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
103 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
104 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
105 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
108 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
109 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
110 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
111 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
112 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.59
Rhizosphere 94.12
Stem 0
Stem Tuber 0
Unclassified 5.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10109798 3300005293 Bacteria 2651
2 Ga0065707_10297319 3300005295 Unclassified 1012
3 Ga0070683_100000022 3300005329 Bacteria 180088
4 Ga0070670_100007244 3300005331 Bacteria 9399
5 Ga0070670_100061186 3300005331 Bacteria 3232
6 Ga0068869_100023926 3300005334 Bacteria 4226
7 Ga0070682_100000082 3300005337 Bacteria 85071
8 Ga0068868_100000399 3300005338 Bacteria 29496
9 Ga0070689_100501253 3300005340 Bacteria 1040
10 Ga0070687_100052706 3300005343 Unclassified 2112
11 Ga0070687_100149140 3300005343 Bacteria 1371
12 Ga0070687_100319548 3300005343 Bacteria 991
13 Ga0070692_10000360 3300005345 Bacteria 13343
14 Ga0070675_100000003 3300005354 Bacteria 422595
15 Ga0070701_10000165 3300005438 Bacteria 20639
16 Ga0070700_100000001 3300005441 Bacteria 346167
17 Ga0070708_100011286 3300005445 Bacteria 7263
18 Ga0070708_100104881 3300005445 Bacteria 2593
19 Ga0068867_100307999 3300005459 Bacteria 1308
20 Ga0070685_10003038 3300005466 Bacteria 8552
21 Ga0070706_100011635 3300005467 Bacteria 8173
22 Ga0070706_100201637 3300005467 Bacteria 1858
23 Ga0070707_100399870 3300005468 Bacteria 1334
24 Ga0070698_100066281 3300005471 Bacteria 3635
25 Ga0070699_100033116 3300005518 Bacteria 4464
26 Ga0070699_100760064 3300005518 Unclassified 886
27 Ga0070684_100000091 3300005535 Bacteria 58992
28 Ga0070684_100301178 3300005535 Bacteria 1471
29 Ga0070697_100505943 3300005536 Bacteria 1056
30 Ga0068853_100612296 3300005539 Bacteria 1035
31 Ga0070672_100014328 3300005543 Bacteria 5618
32 Ga0070672_100395180 3300005543 Bacteria 1184
33 Ga0070696_100422302 3300005546 Bacteria 1047
34 Ga0070693_100007845 3300005547 Bacteria 5235
35 Ga0070693_100157017 3300005547 Bacteria 1446
36 Ga0070704_100192803 3300005549 Bacteria 1639
37 Ga0068857_100115732 3300005577 Bacteria 2412
38 Ga0068854_100050094 3300005578 Bacteria 2986
39 Ga0068854_100057346 3300005578 Bacteria 2809
40 Ga0070702_100009735 3300005615 Bacteria 4713
41 Ga0070702_100182318 3300005615 Bacteria 1375
42 Ga0070702_100298417 3300005615 Bacteria 1113
43 Ga0070702_100491986 3300005615 Bacteria 899
44 Ga0068859_100689977 3300005617 Bacteria 1112
45 Ga0068864_100000001 3300005618 Bacteria 686767
46 Ga0068861_100062167 3300005719 Unclassified 2868
47 Ga0068870_10001487 3300005840 Bacteria 9486
48 Ga0070717_10000127 3300006028 Bacteria 56161
49 Ga0070717_10412584 3300006028 Bacteria 1214
50 Ga0070717_10870556 3300006028 Bacteria 820
51 Ga0075428_100000231 3300006844 Bacteria 54453
52 Ga0075431_100004528 3300006847 Bacteria 13645
53 Ga0075434_100117240 3300006871 Unclassified 2676
54 Ga0075434_100451797 3300006871 Unclassified 1306
55 Ga0075436_100041304 3300006914 Bacteria 3182
56 Ga0097620_100690073 3300006931 Bacteria 1112
57 Ga0075435_100002734 3300007076 Bacteria 11779
58 Ga0075435_100133922 3300007076 Bacteria 2075
59 Ga0105240_10379178 3300009093 Bacteria 1597
60 Ga0111539_10000003 3300009094 Bacteria 880006
61 Ga0105245_10000084 3300009098 Bacteria 94992
62 Ga0105245_10000786 3300009098 Bacteria 28771
63 Ga0105245_10002162 3300009098 Bacteria 17803
64 Ga0105245_10084211 3300009098 Bacteria 2912
65 Ga0105245_10163074 3300009098 Bacteria 2116
66 Ga0105247_10347499 3300009101 Bacteria 1042
67 Ga0105242_10003473 3300009176 Bacteria 12253
68 Ga0105238_10000987 3300009551 Bacteria 29085
69 Ga0105246_10102684 3300011119 Bacteria 2085
70 Ga0157369_10000163 3300013105 Bacteria 94265
71 Ga0157369_10292101 3300013105 Bacteria 1697
72 Ga0157374_10000020 3300013296 Bacteria 276902
73 Ga0157378_10000435 3300013297 Bacteria 40721
74 Ga0157378_10000747 3300013297 Bacteria 30444
75 Ga0157378_10002571 3300013297 Bacteria 16144
76 Ga0157378_10303532 3300013297 Bacteria 1546
77 Ga0163162_10017815 3300013306 Bacteria 6949
78 Ga0163162_10464196 3300013306 Bacteria 1398
79 Ga0157375_10000005 3300013308 Bacteria 429412
80 Ga0157375_10000043 3300013308 Bacteria 157537
81 Ga0157375_10006135 3300013308 Bacteria 10471
82 Ga0157377_10000005 3300014745 Bacteria 426955
83 Ga0157377_10000065 3300014745 Bacteria 80952
84 Ga0157376_10000002 3300014969 Bacteria 684532
85 Ga0213873_10000001 3300021358 Bacteria 1657979
86 Ga0213873_10011416 3300021358 Bacteria 1900
87 Ga0213876_10000002 3300021384 Bacteria 1168769
88 Ga0213876_10000019 3300021384 Bacteria 279426
89 Ga0213876_10001181 3300021384 Bacteria 16516
90 Ga0213876_10195131 3300021384 Bacteria 1076
91 Ga0207645_10118571 3300025907 Bacteria 1717
92 Ga0207643_10017682 3300025908 Bacteria 3901
93 Ga0207684_10308114 3300025910 Bacteria 1365
94 Ga0207660_10013352 3300025917 Bacteria 5383
95 Ga0207662_10017493 3300025918 Bacteria 4057
96 Ga0207662_10266723 3300025918 Unclassified 1129
97 Ga0207646_10284186 3300025922 Bacteria 1495
98 Ga0207646_10382046 3300025922 Bacteria 1272
99 Ga0207646_10489118 3300025922 Bacteria 1109
100 Ga0207694_10000002 3300025924 Bacteria 1165763
101 Ga0207694_10000003 3300025924 Bacteria 1165533
102 Ga0207650_10004496 3300025925 Bacteria 9535
103 Ga0207650_10012378 3300025925 Bacteria 5889
104 Ga0207650_10282454 3300025925 Bacteria 1352
105 Ga0207659_10000006 3300025926 Bacteria 384976
106 Ga0207687_10000019 3300025927 Bacteria 234280
107 Ga0207687_10000623 3300025927 Bacteria 23906
108 Ga0207687_10002123 3300025927 Bacteria 13538
109 Ga0207700_10011696 3300025928 Bacteria 5612
110 Ga0207644_10016408 3300025931 Bacteria 4982
111 Ga0207686_10002285 3300025934 Bacteria 10504
112 Ga0207670_10002325 3300025936 Bacteria 9953
113 Ga0207670_10497359 3300025936 Unclassified 989
114 Ga0207704_10017648 3300025938 Bacteria 3706
115 Ga0207665_10108490 3300025939 Bacteria 1947
116 Ga0207665_10189105 3300025939 Bacteria 1495
117 Ga0207691_10024274 3300025940 Bacteria 5702
118 Ga0207689_10009141 3300025942 Bacteria 8576
119 Ga0207661_10000009 3300025944 Bacteria 421876
120 Ga0207679_10890224 3300025945 Bacteria 814
121 Ga0207651_10205042 3300025960 Unclassified 1583
122 Ga0207640_10001930 3300025981 Bacteria 11165
123 Ga0207640_10240350 3300025981 Bacteria 1399
124 Ga0207677_10000003 3300026023 Bacteria 450061
125 Ga0207677_10000073 3300026023 Bacteria 83861
126 Ga0207703_10000019 3300026035 Bacteria 254885
127 Ga0207639_10000005 3300026041 Bacteria 579948
128 Ga0207708_10000024 3300026075 Bacteria 172863
129 Ga0207648_10075258 3300026089 Bacteria 2943
130 Ga0207676_10000002 3300026095 Bacteria 1198607
131 Ga0207676_10608800 3300026095 Bacteria 1050
132 Ga0207674_10169171 3300026116 Bacteria 2139
133 Ga0207675_100058777 3300026118 Unclassified 3588
134 Ga0207683_10115642 3300026121 Bacteria 2404
135 Ga0207698_10471876 3300026142 Bacteria 1215
136 Ga0207698_10686475 3300026142 Unclassified 1018
137 Ga0207428_10000001 3300027907 Bacteria 1034622
138 Ga0265318_10083487 3300028577 Bacteria 1179
139 Ga0265338_10226817 3300028800 Bacteria 1392
140 Ga0265324_10014904 3300029957 Bacteria 2865
141 Ga0307511_10000120 3300030521 Bacteria 71419
142 Ga0373932_0002901 3300035112 Bacteria 4233
143 Ga0373941_0014518 3300035115 Unclassified 2106
144 Ga0373931_0571310 3300035691 Bacteria 736
145 Ga0436365_0142374 3300039437 Bacteria 217743
146 Ga0436365_0449015 3300039437 Bacteria 112416
147 Ga0436365_1705174 3300039437 Unclassified 1200
148 Ga0436365_1910518 3300039437 Bacteria 85997
149 Ga0436362_0705760 3300039453 Bacteria 6869
150 Ga0436362_0984254 3300039453 Bacteria 405590
151 Ga0451577_0216233 3300042876 Bacteria 1732
152 Ga0451577_0562087 3300042876 Bacteria 1036
153 Ga0466957_0430533 3300044842 Unclassified 906
154 Ga0495620_0000566 3300046515 Bacteria 23353
155 Ga0495598_0077741 3300046537 Bacteria 1059
156 Ga0496100_0071973 3300048903 Bacteria 2310
157 Ga0501073_0035408 3300049589 Unclassified 3550
158 Ga0501080_0002629 3300049742 Bacteria 15721
159 nmdc:mga06r32_2184_c1 3300050510 Bacteria 17529
160 nmdc:mga08y16_1_c1 3300050511 Bacteria 1034622
161 nmdc:mga0n895_127813_c1 3300050512 Unclassified 2565
162 nmdc:mga0n895_280534_c1 3300050512 Bacteria 1689
163 nmdc:mga0n895_385776_c1 3300050512 Bacteria 1417
164 nmdc:mga0n895_496154_c1 3300050512 Bacteria 1230
165 nmdc:mga0n895_642192_c1 3300050512 Bacteria 1061
166 nmdc:mga0rr50_423845_c1 3300050513 Bacteria 1126
167 nmdc:mga0rr50_44316_c1 3300050513 Bacteria 3262
168 nmdc:mga0rr50_96_c1 3300050513 Bacteria 49211
169 nmdc:mga08x19_27783_c1 3300050514 Bacteria 3541
170 Ga0501084_0460773 3300054114 Unclassified 1075

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005466 Ga0070685_10003038 Ga0070685_100030384 217
2 3300025918 Ga0207662_10266723 Ga0207662_102667231 217
3 3300005337 Ga0070682_100000082 Ga0070682_10000008245 219
4 3300005617 Ga0068859_100689977 Ga0068859_1006899772 219
5 3300006931 Ga0097620_100690073 Ga0097620_1006900732 219
6 3300009094 Ga0111539_10000003 Ga0111539_10000003477 219
7 3300009176 Ga0105242_10003473 Ga0105242_100034737 219
8 3300013297 Ga0157378_10002571 Ga0157378_100025717 219
9 3300013306 Ga0163162_10464196 Ga0163162_104641962 219
10 3300025927 Ga0207687_10000623 Ga0207687_1000062322 219
11 3300025934 Ga0207686_10002285 Ga0207686_100022855 219
12 3300025936 Ga0207670_10002325 Ga0207670_100023256 219
13 3300026035 Ga0207703_10000019 Ga0207703_10000019188 219
14 3300027907 Ga0207428_10000001 Ga0207428_10000001626 219
15 3300035112 Ga0373932_0002901 Ga0373932_0002901_1644_2303 219
16 3300035691 Ga0373931_0571310 Ga0373931_0571310_25_684 219
17 3300039437 Ga0436365_0142374 Ga0436365_0142374_205717_206376 219
18 3300044842 Ga0466957_0430533 Ga0466957_0430533_160_819 219
19 3300046537 Ga0495598_0077741 Ga0495598_0077741_34_693 219
20 3300050510 nmdc:mga06r32_2184_c1 nmdc:mga06r32_2184_c1_3254_3913 219
21 3300050511 nmdc:mga08y16_1_c1 nmdc:mga08y16_1_c1_340515_341174 219
22 3300050512 nmdc:mga0n895_127813_c1 nmdc:mga0n895_127813_c1_1651_2310 219
23 3300050513 nmdc:mga0rr50_423845_c1 nmdc:mga0rr50_423845_c1_31_690 219
24 3300054114 Ga0501084_0460773 Ga0501084_0460773_106_765 219
25 3300009101 Ga0105247_10347499 Ga0105247_103474991 229
26 3300025907 Ga0207645_10118571 Ga0207645_101185712 232
27 3300028577 Ga0265318_10083487 Ga0265318_100834872 232
28 3300028800 Ga0265338_10226817 Ga0265338_102268172 232
29 3300029957 Ga0265324_10014904 Ga0265324_100149042 232
30 3300005293 Ga0065715_10109798 Ga0065715_101097983 235
31 3300005295 Ga0065707_10297319 Ga0065707_102973191 235
32 3300005329 Ga0070683_100000022 Ga0070683_10000002291 235
33 3300005331 Ga0070670_100007244 Ga0070670_1000072446 235
34 3300005331 Ga0070670_100061186 Ga0070670_1000611862 235
35 3300005334 Ga0068869_100023926 Ga0068869_1000239262 235
36 3300005338 Ga0068868_100000399 Ga0068868_1000003993 235
37 3300005340 Ga0070689_100501253 Ga0070689_1005012531 235
38 3300005343 Ga0070687_100052706 Ga0070687_1000527063 235
39 3300005343 Ga0070687_100149140 Ga0070687_1001491401 235
40 3300005343 Ga0070687_100319548 Ga0070687_1003195481 235
41 3300005345 Ga0070692_10000360 Ga0070692_100003607 235
42 3300005354 Ga0070675_100000003 Ga0070675_100000003277 235
43 3300005438 Ga0070701_10000165 Ga0070701_100001652 235
44 3300005441 Ga0070700_100000001 Ga0070700_100000001304 235
45 3300005445 Ga0070708_100011286 Ga0070708_1000112864 235
46 3300005445 Ga0070708_100104881 Ga0070708_1001048813 235
47 3300005459 Ga0068867_100307999 Ga0068867_1003079992 235
48 3300005467 Ga0070706_100011635 Ga0070706_1000116353 235
49 3300005467 Ga0070706_100201637 Ga0070706_1002016372 235
50 3300005468 Ga0070707_100399870 Ga0070707_1003998702 235
51 3300005471 Ga0070698_100066281 Ga0070698_1000662813 235
52 3300005518 Ga0070699_100033116 Ga0070699_1000331164 235
53 3300005518 Ga0070699_100760064 Ga0070699_1007600641 235
54 3300005535 Ga0070684_100000091 Ga0070684_10000009146 235
55 3300005535 Ga0070684_100301178 Ga0070684_1003011782 235
56 3300005536 Ga0070697_100505943 Ga0070697_1005059432 235
57 3300005539 Ga0068853_100612296 Ga0068853_1006122962 235
58 3300005543 Ga0070672_100014328 Ga0070672_1000143284 235
59 3300005543 Ga0070672_100395180 Ga0070672_1003951802 235
60 3300005546 Ga0070696_100422302 Ga0070696_1004223022 235
61 3300005547 Ga0070693_100007845 Ga0070693_1000078452 235
62 3300005547 Ga0070693_100157017 Ga0070693_1001570172 235
63 3300005549 Ga0070704_100192803 Ga0070704_1001928032 235
64 3300005577 Ga0068857_100115732 Ga0068857_1001157322 235
65 3300005578 Ga0068854_100050094 Ga0068854_1000500942 235
66 3300005578 Ga0068854_100057346 Ga0068854_1000573462 235
67 3300005615 Ga0070702_100009735 Ga0070702_1000097353 235
68 3300005615 Ga0070702_100182318 Ga0070702_1001823182 235
69 3300005615 Ga0070702_100298417 Ga0070702_1002984172 235
70 3300005615 Ga0070702_100491986 Ga0070702_1004919861 235
71 3300005618 Ga0068864_100000001 Ga0068864_100000001376 235
72 3300005719 Ga0068861_100062167 Ga0068861_1000621673 235
73 3300005840 Ga0068870_10001487 Ga0068870_100014875 235
74 3300006028 Ga0070717_10000127 Ga0070717_1000012714 235
75 3300006028 Ga0070717_10412584 Ga0070717_104125842 235
76 3300006028 Ga0070717_10870556 Ga0070717_108705561 235
77 3300006844 Ga0075428_100000231 Ga0075428_10000023125 235
78 3300006847 Ga0075431_100004528 Ga0075431_1000045289 235
79 3300006871 Ga0075434_100117240 Ga0075434_1001172403 235
80 3300006871 Ga0075434_100451797 Ga0075434_1004517972 235
81 3300006914 Ga0075436_100041304 Ga0075436_1000413042 235
82 3300007076 Ga0075435_100002734 Ga0075435_1000027348 235
83 3300007076 Ga0075435_100133922 Ga0075435_1001339222 235
84 3300009093 Ga0105240_10379178 Ga0105240_103791782 235
85 3300009098 Ga0105245_10000084 Ga0105245_1000008416 235
86 3300009098 Ga0105245_10000786 Ga0105245_1000078628 235
87 3300009098 Ga0105245_10002162 Ga0105245_100021623 235
88 3300009098 Ga0105245_10084211 Ga0105245_100842113 235
89 3300009098 Ga0105245_10163074 Ga0105245_101630742 235
90 3300009551 Ga0105238_10000987 Ga0105238_1000098724 235
91 3300011119 Ga0105246_10102684 Ga0105246_101026842 235
92 3300013105 Ga0157369_10000163 Ga0157369_1000016391 235
93 3300013105 Ga0157369_10292101 Ga0157369_102921012 235
94 3300013296 Ga0157374_10000020 Ga0157374_1000002015 235
95 3300013297 Ga0157378_10000435 Ga0157378_1000043514 235
96 3300013297 Ga0157378_10000747 Ga0157378_1000074713 235
97 3300013297 Ga0157378_10303532 Ga0157378_103035322 235
98 3300013306 Ga0163162_10017815 Ga0163162_100178156 235
99 3300013308 Ga0157375_10000005 Ga0157375_10000005274 235
100 3300013308 Ga0157375_10000043 Ga0157375_1000004322 235
101 3300013308 Ga0157375_10006135 Ga0157375_100061358 235
102 3300014745 Ga0157377_10000005 Ga0157377_10000005144 235
103 3300014745 Ga0157377_10000065 Ga0157377_1000006561 235
104 3300014969 Ga0157376_10000002 Ga0157376_10000002334 235
105 3300021358 Ga0213873_10000001 Ga0213873_10000001556 235
106 3300021358 Ga0213873_10011416 Ga0213873_100114162 235
107 3300021384 Ga0213876_10000002 Ga0213876_10000002986 235
108 3300021384 Ga0213876_10000019 Ga0213876_1000001992 235
109 3300021384 Ga0213876_10001181 Ga0213876_1000118114 235
110 3300021384 Ga0213876_10195131 Ga0213876_101951311 235
111 3300025908 Ga0207643_10017682 Ga0207643_100176822 235
112 3300025910 Ga0207684_10308114 Ga0207684_103081141 235
113 3300025917 Ga0207660_10013352 Ga0207660_100133524 235
114 3300025918 Ga0207662_10017493 Ga0207662_100174932 235
115 3300025922 Ga0207646_10284186 Ga0207646_102841862 235
116 3300025922 Ga0207646_10382046 Ga0207646_103820462 235
117 3300025922 Ga0207646_10489118 Ga0207646_104891182 235
118 3300025924 Ga0207694_10000002 Ga0207694_10000002840 235
119 3300025924 Ga0207694_10000003 Ga0207694_10000003260 235
120 3300025925 Ga0207650_10004496 Ga0207650_100044966 235
121 3300025925 Ga0207650_10012378 Ga0207650_100123784 235
122 3300025925 Ga0207650_10282454 Ga0207650_102824542 235
123 3300025926 Ga0207659_10000006 Ga0207659_1000000691 235
124 3300025927 Ga0207687_10000019 Ga0207687_10000019132 235
125 3300025927 Ga0207687_10002123 Ga0207687_100021235 235
126 3300025928 Ga0207700_10011696 Ga0207700_100116962 235
127 3300025931 Ga0207644_10016408 Ga0207644_100164084 235
128 3300025936 Ga0207670_10497359 Ga0207670_104973592 235
129 3300025938 Ga0207704_10017648 Ga0207704_100176482 235
130 3300025939 Ga0207665_10108490 Ga0207665_101084903 235
131 3300025939 Ga0207665_10189105 Ga0207665_101891052 235
132 3300025940 Ga0207691_10024274 Ga0207691_100242744 235
133 3300025942 Ga0207689_10009141 Ga0207689_100091412 235
134 3300025944 Ga0207661_10000009 Ga0207661_10000009200 235
135 3300025945 Ga0207679_10890224 Ga0207679_108902241 235
136 3300025960 Ga0207651_10205042 Ga0207651_102050422 235
137 3300025981 Ga0207640_10001930 Ga0207640_100019305 235
138 3300025981 Ga0207640_10240350 Ga0207640_102403502 235
139 3300026023 Ga0207677_10000003 Ga0207677_1000000386 235
140 3300026023 Ga0207677_10000073 Ga0207677_1000007338 235
141 3300026041 Ga0207639_10000005 Ga0207639_10000005122 235
142 3300026075 Ga0207708_10000024 Ga0207708_1000002440 235
143 3300026089 Ga0207648_10075258 Ga0207648_100752581 235
144 3300026095 Ga0207676_10000002 Ga0207676_10000002458 235
145 3300026095 Ga0207676_10608800 Ga0207676_106088002 235
146 3300026116 Ga0207674_10169171 Ga0207674_101691712 235
147 3300026118 Ga0207675_100058777 Ga0207675_1000587773 235
148 3300026121 Ga0207683_10115642 Ga0207683_101156423 235
149 3300026142 Ga0207698_10471876 Ga0207698_104718762 235
150 3300026142 Ga0207698_10686475 Ga0207698_106864752 235
151 3300030521 Ga0307511_10000120 Ga0307511_1000012015 235
152 3300035115 Ga0373941_0014518 Ga0373941_0014518_120_827 235
153 3300039437 Ga0436365_0449015 Ga0436365_0449015_101519_102226 235
154 3300039437 Ga0436365_1705174 Ga0436365_1705174_370_1077 235
155 3300039437 Ga0436365_1910518 Ga0436365_1910518_53273_53980 235
156 3300039453 Ga0436362_0705760 Ga0436362_0705760_5018_5725 235
157 3300039453 Ga0436362_0984254 Ga0436362_0984254_400586_401293 235
158 3300042876 Ga0451577_0216233 Ga0451577_0216233_81_788 235
159 3300042876 Ga0451577_0562087 Ga0451577_0562087_277_984 235
160 3300046515 Ga0495620_0000566 Ga0495620_0000566_16008_16715 235
161 3300048903 Ga0496100_0071973 Ga0496100_0071973_1509_2216 235
162 3300049589 Ga0501073_0035408 Ga0501073_0035408_1473_2180 235
163 3300049742 Ga0501080_0002629 Ga0501080_0002629_5454_6161 235
164 3300050512 nmdc:mga0n895_280534_c1 nmdc:mga0n895_280534_c1_786_1493 235
165 3300050512 nmdc:mga0n895_385776_c1 nmdc:mga0n895_385776_c1_266_973 235
166 3300050512 nmdc:mga0n895_496154_c1 nmdc:mga0n895_496154_c1_40_747 235
167 3300050512 nmdc:mga0n895_642192_c1 nmdc:mga0n895_642192_c1_255_962 235
168 3300050513 nmdc:mga0rr50_44316_c1 nmdc:mga0rr50_44316_c1_2337_3044 235
169 3300050513 nmdc:mga0rr50_96_c1 nmdc:mga0rr50_96_c1_8844_9551 235
170 3300050514 nmdc:mga08x19_27783_c1 nmdc:mga08x19_27783_c1_2684_3391 235

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00756

Esterase

Putative esterase

42

257

0.6

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xrt-assembly1.cif.gz_I bacteroides thetaiotaomicron ferulic acid esterase (bt_4077) 0.7968 1 234
7xrt-assembly1.cif.gz_I bacteroides thetaiotaomicron ferulic acid esterase (bt_4077) 0.7905 1 234
7xrv-assembly1.cif.gz_H bacteroides thetaiotaomicron ferulic acid esterase - s150a (bt_4077-s150a) complex with trans-methylferulate 0.779 1 234
3e4d-assembly2.cif.gz_D structural and kinetic study of an s-formylglutathione hydrolase from agrobacterium tumefaciens 0.7759 3 234
5vol-assembly2.cif.gz_G bacint_04212 ferulic acid esterase 0.7744 2 235
ID Description Score Start End Superfamily
af_P31471_131_389_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7689 2 234 3.40.50.1820
3fcxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7623 3 234 3.40.50.1820
af_P31471_131_389_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.76 2 234 3.40.50.1820
1va5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7562 1 234 3.40.50.1820
af_A4HYV9_156_416_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7534 2 235 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2V9JP00-F1-model_v4 Esterase 0.9923 52 235
AF-A0A7Y2HLA6-F1-model_v4 Esterase 0.9897 1 64
AF-A0A7Y5WCF8-F1-model_v4 Esterase family protein 0.9889 1 234
AF-A0A659UKU3-F1-model_v4 Esterase 0.9883 2 106
AF-A0A2V9YDE9-F1-model_v4 Esterase 0.9841 1 105

Feature Viewer

pLDDT pTM Quality
95.66 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map