F254664

General Info

Members Datasets Scaffolds Average Seq Length
169 128 338 161

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10685548|Ga0105242_106855481
Length 179
Sequence MRYGLTLPPFAEWSDPLVIVEMASEAEKLEIGRLGRPHGLRGDVMVTLTTNLEERVTVGTTWWVGDREVTVEGARPHQGRHIVHLSGVEDRDAAAALTGARVFALPVDDAPDGEVWVHEVIGASVVDRAGRAHGRVVAVEANPAHDLLVLDGGGLVPMVFVVEHEGDRVVIDPPDGLLD

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
3 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
61 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
62 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
65 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
66 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
67 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
68 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
71 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
72 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
73 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
74 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
75 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
76 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
77 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
78 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
79 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
80 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
81 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
82 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
83 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
84 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
85 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
86 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
87 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
88 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
89 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
90 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
91 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
92 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
93 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
94 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
95 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
96 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
97 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
98 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
99 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
103 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
104 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
114 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
115 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
116 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
117 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
120 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
121 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
122 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
123 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
124 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
125 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
126 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
127 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
128 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 12.43
Rhizosphere 85.8
Stem 0
Stem Tuber 0
Unclassified 8.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10685548 3300009176 Bacteria 1001
2 Ga0070668_101485330 3300005347 Bacteria 619
3 Ga0070675_100461537 3300005354 Bacteria 1140
4 Ga0070671_101768273 3300005355 Unclassified 549
5 Ga0070674_100364602 3300005356 Bacteria 1171
6 Ga0070688_100942956 3300005365 Bacteria 683
7 Ga0070709_10074675 3300005434 Bacteria 2198
8 Ga0070714_100690961 3300005435 Bacteria 984
9 Ga0070713_100046739 3300005436 Bacteria 3553
10 Ga0070705_100393243 3300005440 Bacteria 1024
11 Ga0070678_100058808 3300005456 Bacteria 2823
12 Ga0070681_10182958 3300005458 Bacteria 2017
13 Ga0070685_10291884 3300005466 Bacteria 1096
14 Ga0070679_101270512 3300005530 Bacteria 682
15 Ga0070697_100336895 3300005536 Bacteria 1301
16 Ga0070672_100172723 3300005543 Bacteria 1798
17 Ga0070686_101277609 3300005544 Viruses 612
18 Ga0070696_100892057 3300005546 Bacteria 737
19 Ga0070693_100153311 3300005547 Bacteria 1461
20 Ga0068857_100837272 3300005577 Bacteria 880
21 Ga0070702_100886263 3300005615 Unclassified 697
22 Ga0068864_100836506 3300005618 Bacteria 906
23 Ga0068858_101260789 3300005842 Bacteria 727
24 Ga0068862_100537693 3300005844 Bacteria 1114
25 Ga0081539_10024369 3300005985 Bacteria 3929
26 Ga0070712_100237952 3300006175 Bacteria 1449
27 Ga0075428_100045839 3300006844 Bacteria 4804
28 Ga0075430_100097957 3300006846 Bacteria 2450
29 Ga0075433_10625642 3300006852 Bacteria 944
30 Ga0068865_100709846 3300006881 Bacteria 860
31 Ga0075435_100930867 3300007076 Bacteria 758
32 Ga0105240_11153863 3300009093 Bacteria 822
33 Ga0111539_10709123 3300009094 Bacteria 1171
34 Ga0105245_10304758 3300009098 Bacteria 1564
35 Ga0105243_10101477 3300009148 Bacteria 2389
36 Ga0105241_10830942 3300009174 Bacteria 853
37 Ga0105241_10946844 3300009174 Bacteria 802
38 Ga0105242_10063339 3300009176 Bacteria 3045
39 Ga0105248_11613516 3300009177 Bacteria 735
40 Ga0105249_11789635 3300009553 Bacteria 687
41 Ga0105246_10533532 3300011119 Bacteria 1002
42 Ga0163162_10959947 3300013306 Bacteria 966
43 Ga0163162_11106832 3300013306 Bacteria 898
44 Ga0207699_10515598 3300025906 Bacteria 864
45 Ga0207707_10107270 3300025912 Bacteria 2442
46 Ga0207693_10152248 3300025915 Bacteria 1819
47 Ga0207664_10419507 3300025929 Bacteria 1192
48 Ga0207644_10555512 3300025931 Bacteria 951
49 Ga0207686_10102241 3300025934 Bacteria 1916
50 Ga0207709_10044968 3300025935 Bacteria 2671
51 Ga0207669_10117591 3300025937 Bacteria 1797
52 Ga0207704_10102477 3300025938 Bacteria 1912
53 Ga0207665_10157471 3300025939 Bacteria 1631
54 Ga0207691_10055848 3300025940 Bacteria 3598
55 Ga0207691_10557030 3300025940 Bacteria 972
56 Ga0207691_10724210 3300025940 Bacteria 838
57 Ga0207711_10799242 3300025941 Bacteria 878
58 Ga0207661_10689200 3300025944 Bacteria 940
59 Ga0207712_10071376 3300025961 Bacteria 2497
60 Ga0207703_10614125 3300026035 Bacteria 1029
61 Ga0207708_10220154 3300026075 Bacteria 1521
62 Ga0207708_11025861 3300026075 Unclassified 717
63 Ga0207648_11026773 3300026089 Unclassified 772
64 Ga0207676_10626136 3300026095 Bacteria 1036
65 Ga0207683_10207007 3300026121 Bacteria 1784
66 Ga0207683_10955264 3300026121 Bacteria 796
67 Ga0265322_10025559 3300028654 Bacteria 1689
68 Ga0265338_10277137 3300028800 Bacteria 1227
69 Ga0265339_10161625 3300031249 Unclassified 1127
70 Ga0265327_10004518 3300031251 Bacteria 12281
71 Ga0265327_10009226 3300031251 Bacteria 7156
72 Ga0265327_10020197 3300031251 Bacteria 4066
73 Ga0265327_10029355 3300031251 Bacteria 3129
74 Ga0316578_10147166 3300031728 Bacteria 1419
75 Ga0307410_10592413 3300031852 Bacteria 924
76 Ga0307409_100119458 3300031995 Bacteria 2229
77 Ga0316574_0034168 3300035398 Bacteria 3098
78 Ga0373935_0911650 3300035692 Bacteria 651
79 Ga0373937_0924023 3300036401 Unclassified 821
80 Ga0373937_1063486 3300036401 Bacteria 758
81 Ga0316584_0544572 3300036712 Bacteria 811
82 Ga0436363_1599339 3300039450 Bacteria 1582
83 Ga0451833_1283072 3300041491 Bacteria 569
84 Ga0495592_0308154 3300046454 Bacteria 1027
85 Ga0495603_0219605 3300046455 Bacteria 1097
86 Ga0495653_0002432 3300046463 Bacteria 14811
87 Ga0495653_0455684 3300046463 Bacteria 804
88 Ga0495653_0551971 3300046463 Bacteria 713
89 Ga0495664_0181050 3300046477 Bacteria 1278
90 Ga0495584_0672841 3300046491 Bacteria 528
91 Ga0495608_0080471 3300046511 Bacteria 2118
92 Ga0495608_0151319 3300046511 Bacteria 1479
93 Ga0495618_0122302 3300046514 Bacteria 1667
94 Ga0495618_0391027 3300046514 Bacteria 852
95 Ga0495628_0003590 3300046516 Bacteria 13884
96 Ga0495628_0527418 3300046516 Bacteria 850
97 Ga0495630_0026741 3300046517 Bacteria 4274
98 Ga0495630_0164726 3300046517 Bacteria 1688
99 Ga0495630_0280519 3300046517 Bacteria 1273
100 Ga0495630_0746043 3300046517 Bacteria 748
101 Ga0495640_0094899 3300046533 Bacteria 1964
102 Ga0495667_0817372 3300046559 Unclassified 574
103 Ga0495668_0646275 3300046616 Bacteria 585
104 Ga0495657_0154939 3300046675 Bacteria 1421
105 Ga0495657_0379523 3300046675 Unclassified 834
106 Ga0495599_0265747 3300046678 Bacteria 1042
107 Ga0495646_0243463 3300046680 Bacteria 966
108 Ga0495604_0558352 3300047317 Unclassified 738
109 Ga0495674_0614611 3300047319 Bacteria 860
110 Ga0495674_0794141 3300047319 Bacteria 737
111 Ga0495676_0464851 3300047321 Bacteria 833
112 Ga0495680_0115120 3300047322 Bacteria 1990
113 Ga0495680_0463181 3300047322 Bacteria 866
114 Ga0495684_0073242 3300047471 Bacteria 2602
115 Ga0495602_0272447 3300048088 Bacteria 1251
116 Ga0496101_0482773 3300048904 Bacteria 979
117 Ga0496101_0662054 3300048904 Bacteria 825
118 Ga0496101_0991203 3300048904 Bacteria 661
119 Ga0496104_0034239 3300048907 Bacteria 4734
120 Ga0496104_0784244 3300048907 Bacteria 859
121 Ga0496105_0076519 3300048908 Bacteria 2763
122 Ga0496106_0012836 3300048909 Bacteria 6184
123 Ga0496108_0128325 3300048911 Bacteria 2179
124 Ga0496108_0292347 3300048911 Bacteria 1419
125 Ga0496108_0444373 3300048911 Unclassified 1133
126 Ga0496109_0005992 3300048912 Bacteria 10213
127 Ga0496109_0072493 3300048912 Bacteria 3164
128 Ga0496110_0097838 3300048913 Bacteria 2629
129 Ga0496111_0053454 3300048914 Bacteria 2919
130 Ga0496112_0022727 3300048915 Bacteria 5982
131 Ga0496112_0040414 3300048915 Bacteria 4560
132 Ga0496112_0963114 3300048915 Bacteria 774
133 Ga0496113_0196236 3300048916 Bacteria 1603
134 Ga0496114_0564105 3300048917 Bacteria 1005
135 Ga0496114_1085997 3300048917 Bacteria 685
136 Ga0496115_0034384 3300048918 Bacteria 4005
137 Ga0501034_0048997 3300049571 Bacteria 4263
138 Ga0501036_0065997 3300049572 Bacteria 3062
139 Ga0501036_0894042 3300049572 Bacteria 729
140 Ga0501037_0169622 3300049573 Bacteria 1552
141 Ga0501039_0820730 3300049575 Bacteria 725
142 Ga0501043_0019245 3300049579 Bacteria 5360
143 Ga0501046_0009392 3300049580 Bacteria 8455
144 Ga0501046_0450238 3300049580 Bacteria 926
145 Ga0501047_0044243 3300049581 Bacteria 4301
146 Ga0501047_0931474 3300049581 Bacteria 682
147 Ga0501070_0003116 3300049586 Bacteria 14448
148 Ga0501070_0751818 3300049586 Unclassified 768
149 Ga0501074_0577177 3300049590 Unclassified 796
150 Ga0501076_1292861 3300049592 Unclassified 600
151 Ga0501076_1300972 3300049592 Bacteria 598
152 Ga0501081_0356386 3300049743 Bacteria 1079
153 Ga0501083_0311434 3300049744 Bacteria 1024
154 Ga0501044_0329853 3300049823 Bacteria 1449
155 nmdc:mga00v17_251698_c1 3300050491 Bacteria 1145
156 nmdc:mga09592_546595_c1 3300050508 Unclassified 995
157 nmdc:mga0qj67_240152_c1 3300050509 Bacteria 1470
158 nmdc:mga0qj67_686013_c1 3300050509 Bacteria 816
159 nmdc:mga0qj67_70372_c1 3300050509 Bacteria 2791
160 nmdc:mga08y16_137860_c1 3300050511 Bacteria 2536
161 nmdc:mga0rr50_408111_c1 3300050513 Bacteria 1148
162 Ga0495601_0290209 3300053077 Bacteria 1066
163 Ga0495612_0109562 3300053078 Bacteria 1181
164 Ga0495595_0070925 3300053084 Bacteria 1647
165 Ga0495619_0073686 3300053085 Bacteria 2288
166 Ga0495619_0153031 3300053085 Bacteria 1591
167 Ga0495619_0271659 3300053085 Bacteria 1175
168 Ga0495619_0320653 3300053085 Unclassified 1073
169 Ga0530510_0477292 3300061734 Bacteria 944
170 Ga0105242_10685548
171 Ga0070668_101485330
172 Ga0070675_100461537
173 Ga0070671_101768273
174 Ga0070674_100364602
175 Ga0070688_100942956
176 Ga0070709_10074675
177 Ga0070714_100690961
178 Ga0070713_100046739
179 Ga0070705_100393243
180 Ga0070678_100058808
181 Ga0070681_10182958
182 Ga0070685_10291884
183 Ga0070679_101270512
184 Ga0070697_100336895
185 Ga0070672_100172723
186 Ga0070686_101277609
187 Ga0070696_100892057
188 Ga0070693_100153311
189 Ga0068857_100837272
190 Ga0070702_100886263
191 Ga0068864_100836506
192 Ga0068858_101260789
193 Ga0068862_100537693
194 Ga0081539_10024369
195 Ga0070712_100237952
196 Ga0075428_100045839
197 Ga0075430_100097957
198 Ga0075433_10625642
199 Ga0068865_100709846
200 Ga0075435_100930867
201 Ga0105240_11153863
202 Ga0111539_10709123
203 Ga0105245_10304758
204 Ga0105243_10101477
205 Ga0105241_10830942
206 Ga0105241_10946844
207 Ga0105242_10063339
208 Ga0105248_11613516
209 Ga0105249_11789635
210 Ga0105246_10533532
211 Ga0163162_10959947
212 Ga0163162_11106832
213 Ga0207699_10515598
214 Ga0207707_10107270
215 Ga0207693_10152248
216 Ga0207664_10419507
217 Ga0207644_10555512
218 Ga0207686_10102241
219 Ga0207709_10044968
220 Ga0207669_10117591
221 Ga0207704_10102477
222 Ga0207665_10157471
223 Ga0207691_10055848
224 Ga0207691_10557030
225 Ga0207691_10724210
226 Ga0207711_10799242
227 Ga0207661_10689200
228 Ga0207712_10071376
229 Ga0207703_10614125
230 Ga0207708_10220154
231 Ga0207708_11025861
232 Ga0207648_11026773
233 Ga0207676_10626136
234 Ga0207683_10207007
235 Ga0207683_10955264
236 Ga0265322_10025559
237 Ga0265338_10277137
238 Ga0265339_10161625
239 Ga0265327_10004518
240 Ga0265327_10009226
241 Ga0265327_10020197
242 Ga0265327_10029355
243 Ga0316578_10147166
244 Ga0307410_10592413
245 Ga0307409_100119458
246 Ga0316574_0034168
247 Ga0373935_0911650
248 Ga0373937_0924023
249 Ga0373937_1063486
250 Ga0316584_0544572
251 Ga0436363_1599339
252 Ga0451833_1283072
253 Ga0495592_0308154
254 Ga0495603_0219605
255 Ga0495653_0002432
256 Ga0495653_0455684
257 Ga0495653_0551971
258 Ga0495664_0181050
259 Ga0495584_0672841
260 Ga0495608_0080471
261 Ga0495608_0151319
262 Ga0495618_0122302
263 Ga0495618_0391027
264 Ga0495628_0003590
265 Ga0495628_0527418
266 Ga0495630_0026741
267 Ga0495630_0164726
268 Ga0495630_0280519
269 Ga0495630_0746043
270 Ga0495640_0094899
271 Ga0495667_0817372
272 Ga0495668_0646275
273 Ga0495657_0154939
274 Ga0495657_0379523
275 Ga0495599_0265747
276 Ga0495646_0243463
277 Ga0495604_0558352
278 Ga0495674_0614611
279 Ga0495674_0794141
280 Ga0495676_0464851
281 Ga0495680_0115120
282 Ga0495680_0463181
283 Ga0495684_0073242
284 Ga0495602_0272447
285 Ga0496101_0482773
286 Ga0496101_0662054
287 Ga0496101_0991203
288 Ga0496104_0034239
289 Ga0496104_0784244
290 Ga0496105_0076519
291 Ga0496106_0012836
292 Ga0496108_0128325
293 Ga0496108_0292347
294 Ga0496108_0444373
295 Ga0496109_0005992
296 Ga0496109_0072493
297 Ga0496110_0097838
298 Ga0496111_0053454
299 Ga0496112_0022727
300 Ga0496112_0040414
301 Ga0496112_0963114
302 Ga0496113_0196236
303 Ga0496114_0564105
304 Ga0496114_1085997
305 Ga0496115_0034384
306 Ga0501034_0048997
307 Ga0501036_0065997
308 Ga0501036_0894042
309 Ga0501037_0169622
310 Ga0501039_0820730
311 Ga0501043_0019245
312 Ga0501046_0009392
313 Ga0501046_0450238
314 Ga0501047_0044243
315 Ga0501047_0931474
316 Ga0501070_0003116
317 Ga0501070_0751818
318 Ga0501074_0577177
319 Ga0501076_1292861
320 Ga0501076_1300972
321 Ga0501081_0356386
322 Ga0501083_0311434
323 Ga0501044_0329853
324 nmdc:mga00v17_251698_c1
325 nmdc:mga09592_546595_c1
326 nmdc:mga0qj67_240152_c1
327 nmdc:mga0qj67_686013_c1
328 nmdc:mga0qj67_70372_c1
329 nmdc:mga08y16_137860_c1
330 nmdc:mga0rr50_408111_c1
331 Ga0495601_0290209
332 Ga0495612_0109562
333 Ga0495595_0070925
334 Ga0495619_0073686
335 Ga0495619_0153031
336 Ga0495619_0271659
337 Ga0495619_0320653
338 Ga0530510_0477292

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01782

RimM

RimM N-terminal domain

30

107

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dog-assembly1.cif.gz_A solution structure of the n-terminal domain of rimm from thermus thermophilus hb8 0.8252 18 104
7cq1-assembly1.cif.gz_A solution structure of the c-terminal domain of mycobacterium tuberculosis ribosome maturation factor protein rimm 0.8057 104 169
2dog-assembly1.cif.gz_A solution structure of the n-terminal domain of rimm from thermus thermophilus hb8 0.7998 18 104
3a1p-assembly2.cif.gz_C structure of ribosome maturation protein rimm and ribosomal protein s19 0.7948 18 169
1pm3-assembly1.cif.gz_A mth1859 0.7519 107 165
ID Description Score Start End Superfamily
af_Q2FZ44_1_87_2.40.30.60 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM 0.9267 18 96 2.40.30.60
af_Q8IJ86_392_490_2.40.30.60 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM 0.8934 16 96 2.40.30.60
af_P9WH19_99_175_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.8811 101 168 2.30.30.240
af_A0A1D6MCY5_87_186_2.40.30.60 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM 0.854 14 100 2.40.30.60
3a1pC01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM 0.8405 18 101 2.40.30.60
ID Description Score Start End GO Terms
AF-A0A0R2Q9U0-F1-model_v4 PRC-barrel domain-containing protein 0.9936 111 167
AF-A0A658NGZ9-F1-model_v4 Ribosome maturation factor RimM 0.9683 21 100 GO:0006364
AF-A0A658NGZ9-F1-model_v4 Ribosome maturation factor RimM 0.9566 21 100 GO:0006364
AF-A0A6J7A2L8-F1-model_v4 Unannotated protein 0.9379 52 167 GO:0006364
AF-A0A350BDG0-F1-model_v4 Ribosome maturation factor RimM 0.905 18 167 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022

Map