F254557

General Info

Members Datasets Scaffolds Average Seq Length
169 108 338 91

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100394378|Ga0075436_1003943783
Length 109
Sequence LVLRTWVAVRKQPGVIMPKTLYMVIEHFKNRDALPVYRRFRDRGRMTPEGLVYRSSWVDEKFERCFQLMEADDPALLEDWMARWRDLVDFEVYAVATSQDAAAKIAPLL

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
104 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
105 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
106 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
107 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
108 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 0.59
Rhizosphere 98.22
Stem 0
Stem Tuber 0
Unclassified 39.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_100394378 3300006914 Bacteria 1002
2 Ga0070690_100026552 3300005330 Unclassified 3573
3 Ga0070689_101652626 3300005340 Unclassified 582
4 Ga0070687_100203646 3300005343 Unclassified 1201
5 Ga0070669_100533279 3300005353 Bacteria 977
6 Ga0070674_102162219 3300005356 Bacteria 508
7 Ga0070667_101351337 3300005367 Bacteria 668
8 Ga0070709_10191729 3300005434 Bacteria 1442
9 Ga0070711_100093453 3300005439 Bacteria 2172
10 Ga0070694_101914725 3300005444 Unclassified 506
11 Ga0070708_100047171 3300005445 Unclassified 3804
12 Ga0070708_100110204 3300005445 Bacteria 2529
13 Ga0070708_101259424 3300005445 Bacteria 691
14 Ga0068867_100022681 3300005459 Bacteria 4490
15 Ga0068867_100667648 3300005459 Unclassified 914
16 Ga0070706_100004811 3300005467 Bacteria 12932
17 Ga0070706_100359470 3300005467 Unclassified 1357
18 Ga0070707_100464015 3300005468 Bacteria 1227
19 Ga0070707_101086799 3300005468 Unclassified 766
20 Ga0070698_100000672 3300005471 Bacteria 36516
21 Ga0070698_100089936 3300005471 Bacteria 3054
22 Ga0070698_100358853 3300005471 Bacteria 1389
23 Ga0070698_100600618 3300005471 Bacteria 1041
24 Ga0070698_100890537 3300005471 Unclassified 835
25 Ga0070698_100966102 3300005471 Bacteria 798
26 Ga0070698_101326937 3300005471 Unclassified 670
27 Ga0070699_100008768 3300005518 Bacteria 8764
28 Ga0070699_100153343 3300005518 Bacteria 2038
29 Ga0070699_100451365 3300005518 Bacteria 1166
30 Ga0070699_101923057 3300005518 Unclassified 541
31 Ga0070697_100044895 3300005536 Bacteria 3580
32 Ga0070697_100067982 3300005536 Bacteria 2916
33 Ga0070697_100195826 3300005536 Bacteria 1716
34 Ga0070697_100266351 3300005536 Bacteria 1468
35 Ga0070697_100745023 3300005536 Unclassified 866
36 Ga0068853_101066246 3300005539 Unclassified 779
37 Ga0070686_100016145 3300005544 Bacteria 4340
38 Ga0070696_100657019 3300005546 Bacteria 850
39 Ga0070693_100453672 3300005547 Bacteria 900
40 Ga0070665_100232189 3300005548 Bacteria 1845
41 Ga0070665_100284084 3300005548 Bacteria 1657
42 Ga0070704_100044783 3300005549 Unclassified 3077
43 Ga0070704_100192764 3300005549 Bacteria 1639
44 Ga0068857_100032422 3300005577 Bacteria 4619
45 Ga0068857_100108934 3300005577 Bacteria 2489
46 Ga0068854_100243950 3300005578 Bacteria 1432
47 Ga0068852_102597946 3300005616 Unclassified 526
48 Ga0068859_100344939 3300005617 Bacteria 1584
49 Ga0068859_100462149 3300005617 Unclassified 1365
50 Ga0068866_10329629 3300005718 Unclassified 963
51 Ga0068861_100043948 3300005719 Unclassified 3357
52 Ga0068870_10033601 3300005840 Bacteria 2619
53 Ga0068863_100176018 3300005841 Bacteria 2053
54 Ga0068860_100222517 3300005843 Unclassified 1833
55 Ga0068860_102354793 3300005843 Bacteria 553
56 Ga0068862_100340913 3300005844 Unclassified 1388
57 Ga0068862_101573658 3300005844 Bacteria 664
58 Ga0070716_100860357 3300006173 Bacteria 707
59 Ga0070712_100087539 3300006175 Bacteria 2273
60 Ga0070712_100531369 3300006175 Bacteria 989
61 Ga0097621_100660271 3300006237 Bacteria 960
62 Ga0075428_100462770 3300006844 Bacteria 1358
63 Ga0075431_100560759 3300006847 Bacteria 1129
64 Ga0075434_100676547 3300006871 Unclassified 1050
65 Ga0075434_102455718 3300006871 Unclassified 523
66 Ga0075429_101599436 3300006880 Unclassified 566
67 Ga0068865_100191491 3300006881 Bacteria 1582
68 Ga0075436_100236314 3300006914 Unclassified 1299
69 Ga0075436_100239527 3300006914 Unclassified 1290
70 Ga0097620_100344936 3300006931 Bacteria 1584
71 Ga0097620_100462167 3300006931 Unclassified 1365
72 Ga0097620_101062364 3300006931 Unclassified 890
73 Ga0099794_10447084 3300007265 Unclassified 677
74 Ga0105240_10159906 3300009093 Bacteria 2676
75 Ga0105245_13102140 3300009098 Unclassified 515
76 Ga0105245_13185548 3300009098 Unclassified 508
77 Ga0105247_10749318 3300009101 Bacteria 740
78 Ga0114129_10023053 3300009147 Bacteria 8832
79 Ga0114129_10077681 3300009147 Bacteria 4617
80 Ga0114129_10325102 3300009147 Bacteria 2044
81 Ga0114129_10553308 3300009147 Bacteria 1496
82 Ga0105243_10246209 3300009148 Bacteria 1593
83 Ga0105243_11785599 3300009148 Unclassified 646
84 Ga0105241_10000127 3300009174 Bacteria 54861
85 Ga0105242_10247480 3300009176 Bacteria 1605
86 Ga0105242_10451645 3300009176 Bacteria 1212
87 Ga0105242_11975842 3300009176 Unclassified 625
88 Ga0105248_10601369 3300009177 Bacteria 1241
89 Ga0105248_11335489 3300009177 Bacteria 811
90 Ga0105237_10425376 3300009545 Bacteria 1334
91 Ga0105237_10453593 3300009545 Unclassified 1288
92 Ga0105238_12303755 3300009551 Unclassified 574
93 Ga0105249_10275973 3300009553 Bacteria 1676
94 Ga0105249_10299197 3300009553 Bacteria 1613
95 Ga0105249_12574656 3300009553 Bacteria 581
96 Ga0157373_10209085 3300013100 Bacteria 1376
97 Ga0157369_10022783 3300013105 Bacteria 6984
98 Ga0157374_10612885 3300013296 Unclassified 1099
99 Ga0157378_10512327 3300013297 Bacteria 1200
100 Ga0163162_12144633 3300013306 Bacteria 641
101 Ga0157372_11361565 3300013307 Bacteria 818
102 Ga0157375_10256288 3300013308 Bacteria 1911
103 Ga0157375_12623396 3300013308 Bacteria 602
104 Ga0157376_12532348 3300014969 Unclassified 553
105 Ga0207680_10251871 3300025903 Unclassified 1220
106 Ga0207684_10392607 3300025910 Unclassified 1193
107 Ga0207654_10000368 3300025911 Bacteria 26431
108 Ga0207695_10089150 3300025913 Bacteria 3102
109 Ga0207695_10254462 3300025913 Bacteria 1655
110 Ga0207671_11102736 3300025914 Unclassified 623
111 Ga0207693_10007917 3300025915 Bacteria 8729
112 Ga0207663_10292213 3300025916 Bacteria 1214
113 Ga0207662_10059578 3300025918 Bacteria 2288
114 Ga0207646_10000833 3300025922 Bacteria 40133
115 Ga0207646_10115988 3300025922 Bacteria 2405
116 Ga0207646_10750759 3300025922 Unclassified 871
117 Ga0207646_10959973 3300025922 Unclassified 757
118 Ga0207646_11783331 3300025922 Unclassified 527
119 Ga0207681_10551212 3300025923 Unclassified 949
120 Ga0207694_10599547 3300025924 Unclassified 926
121 Ga0207659_10733845 3300025926 Bacteria 847
122 Ga0207687_11245876 3300025927 Bacteria 639
123 Ga0207700_10854621 3300025928 Unclassified 814
124 Ga0207686_10905070 3300025934 Unclassified 712
125 Ga0207686_10927376 3300025934 Bacteria 704
126 Ga0207709_10019083 3300025935 Bacteria 3848
127 Ga0207709_10700848 3300025935 Unclassified 810
128 Ga0207670_10832185 3300025936 Bacteria 770
129 Ga0207665_10630981 3300025939 Bacteria 839
130 Ga0207665_11638973 3300025939 Unclassified 510
131 Ga0207711_10409193 3300025941 Unclassified 1261
132 Ga0207711_10507183 3300025941 Bacteria 1124
133 Ga0207689_11195841 3300025942 Unclassified 640
134 Ga0207712_10580214 3300025961 Bacteria 968
135 Ga0207712_10720843 3300025961 Bacteria 872
136 Ga0207640_10169319 3300025981 Bacteria 1626
137 Ga0207677_10286986 3300026023 Unclassified 1353
138 Ga0207641_10162397 3300026088 Unclassified 2032
139 Ga0207641_11034096 3300026088 Bacteria 819
140 Ga0207648_10250829 3300026089 Unclassified 1578
141 Ga0207674_10013445 3300026116 Bacteria 9084
142 Ga0207674_10091809 3300026116 Unclassified 3026
143 Ga0207675_100161479 3300026118 Unclassified 2137
144 Ga0207675_100607914 3300026118 Bacteria 1097
145 Ga0209588_1111779 3300027671 Unclassified 877
146 Ga0268266_10207682 3300028379 Bacteria 1795
147 Ga0268266_10800527 3300028379 Unclassified 910
148 Ga0268264_10721015 3300028381 Bacteria 992
149 Ga0268264_10731894 3300028381 Unclassified 984
150 Ga0268264_11287080 3300028381 Bacteria 741
151 Ga0307410_12144266 3300031852 Unclassified 500
152 Ga0373940_0201272 3300035088 Bacteria 655
153 Ga0373935_0011076 3300035692 Bacteria 5417
154 Ga0395905_0339067 3300037471 Bacteria 1394
155 Ga0395905_0611476 3300037471 Bacteria 992
156 Ga0436365_0737855 3300039437 Unclassified 1307
157 Ga0439435_0267711 3300042436 Archaea 579
158 Ga0451576_0095957 3300045051 Bacteria 3084
159 Ga0451576_0549044 3300045051 Bacteria 1214
160 Ga0466967_0670582 3300045976 Viruses 1026
161 Ga0496109_1189416 3300048912 Unclassified 699
162 Ga0501042_0934061 3300049578 Unclassified 632
163 Ga0501048_0114536 3300049582 Bacteria 1905
164 nmdc:mga05p37_1130826_c1 3300050507 Unclassified 817
165 nmdc:mga05p37_580887_c1 3300050507 Unclassified 1269
166 nmdc:mga09592_767796_c1 3300050508 Unclassified 817
167 nmdc:mga0n895_2048707_c1 3300050512 Unclassified 529
168 nmdc:mga0rr50_88239_c1 3300050513 Bacteria 2409
169 Ga0500628_000324 3300053129 Bacteria 9167
170 Ga0075436_100394378
171 Ga0070690_100026552
172 Ga0070689_101652626
173 Ga0070687_100203646
174 Ga0070669_100533279
175 Ga0070674_102162219
176 Ga0070667_101351337
177 Ga0070709_10191729
178 Ga0070711_100093453
179 Ga0070694_101914725
180 Ga0070708_100047171
181 Ga0070708_100110204
182 Ga0070708_101259424
183 Ga0068867_100022681
184 Ga0068867_100667648
185 Ga0070706_100004811
186 Ga0070706_100359470
187 Ga0070707_100464015
188 Ga0070707_101086799
189 Ga0070698_100000672
190 Ga0070698_100089936
191 Ga0070698_100358853
192 Ga0070698_100600618
193 Ga0070698_100890537
194 Ga0070698_100966102
195 Ga0070698_101326937
196 Ga0070699_100008768
197 Ga0070699_100153343
198 Ga0070699_100451365
199 Ga0070699_101923057
200 Ga0070697_100044895
201 Ga0070697_100067982
202 Ga0070697_100195826
203 Ga0070697_100266351
204 Ga0070697_100745023
205 Ga0068853_101066246
206 Ga0070686_100016145
207 Ga0070696_100657019
208 Ga0070693_100453672
209 Ga0070665_100232189
210 Ga0070665_100284084
211 Ga0070704_100044783
212 Ga0070704_100192764
213 Ga0068857_100032422
214 Ga0068857_100108934
215 Ga0068854_100243950
216 Ga0068852_102597946
217 Ga0068859_100344939
218 Ga0068859_100462149
219 Ga0068866_10329629
220 Ga0068861_100043948
221 Ga0068870_10033601
222 Ga0068863_100176018
223 Ga0068860_100222517
224 Ga0068860_102354793
225 Ga0068862_100340913
226 Ga0068862_101573658
227 Ga0070716_100860357
228 Ga0070712_100087539
229 Ga0070712_100531369
230 Ga0097621_100660271
231 Ga0075428_100462770
232 Ga0075431_100560759
233 Ga0075434_100676547
234 Ga0075434_102455718
235 Ga0075429_101599436
236 Ga0068865_100191491
237 Ga0075436_100236314
238 Ga0075436_100239527
239 Ga0097620_100344936
240 Ga0097620_100462167
241 Ga0097620_101062364
242 Ga0099794_10447084
243 Ga0105240_10159906
244 Ga0105245_13102140
245 Ga0105245_13185548
246 Ga0105247_10749318
247 Ga0114129_10023053
248 Ga0114129_10077681
249 Ga0114129_10325102
250 Ga0114129_10553308
251 Ga0105243_10246209
252 Ga0105243_11785599
253 Ga0105241_10000127
254 Ga0105242_10247480
255 Ga0105242_10451645
256 Ga0105242_11975842
257 Ga0105248_10601369
258 Ga0105248_11335489
259 Ga0105237_10425376
260 Ga0105237_10453593
261 Ga0105238_12303755
262 Ga0105249_10275973
263 Ga0105249_10299197
264 Ga0105249_12574656
265 Ga0157373_10209085
266 Ga0157369_10022783
267 Ga0157374_10612885
268 Ga0157378_10512327
269 Ga0163162_12144633
270 Ga0157372_11361565
271 Ga0157375_10256288
272 Ga0157375_12623396
273 Ga0157376_12532348
274 Ga0207680_10251871
275 Ga0207684_10392607
276 Ga0207654_10000368
277 Ga0207695_10089150
278 Ga0207695_10254462
279 Ga0207671_11102736
280 Ga0207693_10007917
281 Ga0207663_10292213
282 Ga0207662_10059578
283 Ga0207646_10000833
284 Ga0207646_10115988
285 Ga0207646_10750759
286 Ga0207646_10959973
287 Ga0207646_11783331
288 Ga0207681_10551212
289 Ga0207694_10599547
290 Ga0207659_10733845
291 Ga0207687_11245876
292 Ga0207700_10854621
293 Ga0207686_10905070
294 Ga0207686_10927376
295 Ga0207709_10019083
296 Ga0207709_10700848
297 Ga0207670_10832185
298 Ga0207665_10630981
299 Ga0207665_11638973
300 Ga0207711_10409193
301 Ga0207711_10507183
302 Ga0207689_11195841
303 Ga0207712_10580214
304 Ga0207712_10720843
305 Ga0207640_10169319
306 Ga0207677_10286986
307 Ga0207641_10162397
308 Ga0207641_11034096
309 Ga0207648_10250829
310 Ga0207674_10013445
311 Ga0207674_10091809
312 Ga0207675_100161479
313 Ga0207675_100607914
314 Ga0209588_1111779
315 Ga0268266_10207682
316 Ga0268266_10800527
317 Ga0268264_10721015
318 Ga0268264_10731894
319 Ga0268264_11287080
320 Ga0307410_12144266
321 Ga0373940_0201272
322 Ga0373935_0011076
323 Ga0395905_0339067
324 Ga0395905_0611476
325 Ga0436365_0737855
326 Ga0439435_0267711
327 Ga0451576_0095957
328 Ga0451576_0549044
329 Ga0466967_0670582
330 Ga0496109_1189416
331 Ga0501042_0934061
332 Ga0501048_0114536
333 nmdc:mga05p37_1130826_c1
334 nmdc:mga05p37_580887_c1
335 nmdc:mga09592_767796_c1
336 nmdc:mga0n895_2048707_c1
337 nmdc:mga0rr50_88239_c1
338 Ga0500628_000324

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11746

DUF3303

Domain of unknown function (DUF3303)

20

109

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.6802 1 79
4pcq-assembly1.cif.gz_B crystal structure of mtbaldr (rv2779c) 0.6731 2 79
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.661 1 79
3c1n-assembly3.cif.gz_C crystal structure of allosteric inhibition threonine-sensitive aspartokinase from methanococcus jannaschii with l-threonine 0.6413 2 75
2qmw-assembly1.cif.gz_B-2 the crystal structure of the prephenate dehydratase (pdt) from staphylococcus aureus subsp. aureus mu50 0.6354 2 74
ID Description Score Start End Superfamily
af_P76092_330_583_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7532 31 53 3.40.50.150
af_Q2G1I7_88_170_3.30.70.3090 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.7336 3 76 3.30.70.3090
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.6835 32 54 3.40.430.10
af_B7ZZ41_1_67_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6766 4 68 3.30.70.100
af_F4K0K4_7_79_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6664 1 75 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A521H3A0-F1-model_v4 DUF3303 domain-containing protein 0.9976 5 87
AF-A0A7V8XRM9-F1-model_v4 DUF3303 family protein 0.9975 2 87
AF-A0A838DMF1-F1-model_v4 DUF3303 family protein 0.9966 1 87
AF-A0A6A6I690-F1-model_v4 DUF3303 domain-containing protein 0.9953 1 86
AF-A0A2V6U4X1-F1-model_v4 DUF3303 domain-containing protein 0.9939 1 85

Map