F254491

General Info

Members Datasets Scaffolds Average Seq Length
169 117 169 265

Family's Representative Sequence

Representative Sequence 3300006186|Ga0075369_10000002|Ga0075369_10000002147
Length 284
Sequence MALIAIECQSSRLILLYNYYMDRSYWLQQTKGKLLYPDMEWSRPENRMTAGKLLVVGGNLHGFAAPAEAYGEANKAGVGTVRVLLPASIQKIVGQVLADGEYAPSTPSGSFSQKALNDMLSLGAWADAVLIAGDLGRNSETAILLEKFLAKSPSIVTLSKDSVDYAVATPSSVLERAAPTMLVLSLSQLQRLAIAAKFPKAVTFSMGILHLAEWLHSFTSQHPPLIIVKHHDQLLVAVHGQVSSTKLSKEMPVWRVRAAAHASVWWLQNPAKPYEAITTAIGLL

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
51 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
87 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
88 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
89 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
90 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
91 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
92 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
93 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
94 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
95 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
96 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
97 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
98 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
99 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
100 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
101 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
102 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
103 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
104 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
105 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
106 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
107 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
108 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
109 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
110 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
111 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
112 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
113 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
114 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
115 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
116 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
117 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.59
Nodule 0
Rhizoplane 0
Rhizosphere 68.05
Stem 0
Stem Tuber 0
Unclassified 2.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1004980 3300001915 Unclassified 2848
2 JGI24740J21852_10011761 3300001979 Bacteria 3321
3 JGI24737J22298_10000007 3300001990 Bacteria 62489
4 JGI24735J21928_10000034 3300002067 Bacteria 67726
5 JGI24742J22300_10000005 3300002244 Bacteria 41211
6 rootH2_10123135 3300003320 Unclassified 2948
7 rootL2_10122815 3300003322 Bacteria 1786
8 rootL2_10295348 3300003322 Unclassified 2853
9 rootH1_10186764 3300003323 Bacteria 1682
10 Ga0070658_10001707 3300005327 Bacteria 18542
11 Ga0070658_10468702 3300005327 Bacteria 1086
12 Ga0070676_10010113 3300005328 Bacteria 5111
13 Ga0070683_100000687 3300005329 Bacteria 24489
14 Ga0070683_100000790 3300005329 Bacteria 23356
15 Ga0070690_100016558 3300005330 Bacteria 4419
16 Ga0070666_10012370 3300005335 Bacteria 5381
17 Ga0070666_10026666 3300005335 Unclassified 3778
18 Ga0070660_100000591 3300005339 Bacteria 24338
19 Ga0070689_100584023 3300005340 Unclassified 966
20 Ga0070691_10004129 3300005341 Bacteria 6595
21 Ga0070668_100669219 3300005347 Bacteria 913
22 Ga0070675_100361242 3300005354 Bacteria 1289
23 Ga0070671_100000001 3300005355 Bacteria 1228151
24 Ga0070659_100000841 3300005366 Bacteria 22388
25 Ga0070667_100000001 3300005367 Bacteria 1108638
26 Ga0070667_100017107 3300005367 Bacteria 6007
27 Ga0070700_100043599 3300005441 Unclassified 2760
28 Ga0070678_100003651 3300005456 Bacteria 8591
29 Ga0070681_10322158 3300005458 Bacteria 1455
30 Ga0070679_100014676 3300005530 Bacteria 7529
31 Ga0070684_100000982 3300005535 Bacteria 20351
32 Ga0070684_100003367 3300005535 Bacteria 11971
33 Ga0070684_100168923 3300005535 Unclassified 1986
34 Ga0070684_100261707 3300005535 Bacteria 1582
35 Ga0068853_100071467 3300005539 Bacteria 3022
36 Ga0070686_100052922 3300005544 Unclassified 2590
37 Ga0068855_100000003 3300005563 Bacteria 589862
38 Ga0068855_100003406 3300005563 Bacteria 19472
39 Ga0068855_100224511 3300005563 Bacteria 2105
40 Ga0068857_100000011 3300005577 Bacteria 106771
41 Ga0068857_100231682 3300005577 Bacteria 1689
42 Ga0068857_100233882 3300005577 Unclassified 1681
43 Ga0068856_100003765 3300005614 Bacteria 15204
44 Ga0068852_100073544 3300005616 Bacteria 3007
45 Ga0068860_100003949 3300005843 Bacteria 15230
46 Ga0068860_100721437 3300005843 Unclassified 1007
47 Ga0081455_10000003 3300005937 Bacteria 367763
48 Ga0075365_10000031 3300006038 Bacteria 56060
49 Ga0075365_10006167 3300006038 Bacteria 6565
50 Ga0075365_10128945 3300006038 Unclassified 1749
51 Ga0075364_10000634 3300006051 Bacteria 18140
52 Ga0075364_10023441 3300006051 Bacteria 3908
53 Ga0075364_10097009 3300006051 Bacteria 1960
54 Ga0075362_10000533 3300006177 Bacteria 11078
55 Ga0075367_10001680 3300006178 Bacteria 9665
56 Ga0075369_10000002 3300006186 Bacteria 216197
57 Ga0075369_10000015 3300006186 Bacteria 57194
58 Ga0075369_10150347 3300006186 Unclassified 1064
59 Ga0075366_10000001 3300006195 Bacteria 569172
60 Ga0075366_10000050 3300006195 Bacteria 42254
61 Ga0075366_10000113 3300006195 Bacteria 33132
62 Ga0075366_10001300 3300006195 Bacteria 12443
63 Ga0075366_10047239 3300006195 Bacteria 2551
64 Ga0075366_10103352 3300006195 Bacteria 1711
65 Ga0075366_10249143 3300006195 Bacteria 1083
66 Ga0075370_10060734 3300006353 Bacteria 2153
67 Ga0075430_100010775 3300006846 Bacteria 7749
68 Ga0105240_10044959 3300009093 Bacteria 5605
69 Ga0111539_10016317 3300009094 Bacteria 9207
70 Ga0105245_10000001 3300009098 Bacteria 939270
71 Ga0105243_10401982 3300009148 Bacteria 1273
72 Ga0105241_10000007 3300009174 Bacteria 343524
73 Ga0105241_10003398 3300009174 Bacteria 11846
74 Ga0105241_10030132 3300009174 Bacteria 4053
75 Ga0105238_10297044 3300009551 Unclassified 1598
76 Ga0105249_10000281 3300009553 Bacteria 53346
77 Ga0105033_100149 3300009986 Bacteria 5255
78 Ga0105028_101313 3300009993 Unclassified 2622
79 Ga0157373_10000174 3300013100 Bacteria 52668
80 Ga0157373_10022900 3300013100 Bacteria 4531
81 Ga0157369_10000643 3300013105 Bacteria 45102
82 Ga0157369_10047242 3300013105 Bacteria 4676
83 Ga0157369_10149673 3300013105 Archaea 2467
84 Ga0157374_10003375 3300013296 Bacteria 13415
85 Ga0157374_10112712 3300013296 Unclassified 2617
86 Ga0157372_10004952 3300013307 Bacteria 14149
87 Ga0163163_10030694 3300014325 Bacteria 5181
88 Ga0207680_10014894 3300025903 Bacteria 4042
89 Ga0207680_10120819 3300025903 Bacteria 1713
90 Ga0207645_10015245 3300025907 Bacteria 5115
91 Ga0207705_10011566 3300025909 Bacteria 6380
92 Ga0207705_10166080 3300025909 Bacteria 1660
93 Ga0207654_10000002 3300025911 Bacteria 1460142
94 Ga0207654_10005499 3300025911 Bacteria 6410
95 Ga0207654_10019339 3300025911 Unclassified 3593
96 Ga0207707_10280618 3300025912 Bacteria 1443
97 Ga0207695_10088871 3300025913 Bacteria 3108
98 Ga0207657_10000697 3300025919 Bacteria 35688
99 Ga0207652_10003866 3300025921 Bacteria 12267
100 Ga0207652_10199542 3300025921 Bacteria 1801
101 Ga0207694_10215150 3300025924 Unclassified 1566
102 Ga0207687_10000004 3300025927 Bacteria 841177
103 Ga0207644_10000001 3300025931 Bacteria 1243214
104 Ga0207690_10000643 3300025932 Bacteria 22392
105 Ga0207661_10000029 3300025944 Bacteria 172511
106 Ga0207661_10002965 3300025944 Bacteria 11742
107 Ga0207667_10000008 3300025949 Bacteria 625138
108 Ga0207667_10003465 3300025949 Bacteria 19472
109 Ga0207667_10390002 3300025949 Bacteria 1418
110 Ga0207712_10000971 3300025961 Bacteria 20645
111 Ga0207658_10000003 3300025986 Bacteria 1151934
112 Ga0207658_10028229 3300025986 Bacteria 3950
113 Ga0207639_10041499 3300026041 Bacteria 3443
114 Ga0207702_10011559 3300026078 Bacteria 7356
115 Ga0207674_10000001 3300026116 Bacteria 616581
116 Ga0207674_10057011 3300026116 Bacteria 3962
117 Ga0207683_10044335 3300026121 Bacteria 3888
118 Ga0207698_10456333 3300026142 Bacteria 1235
119 Ga0207428_10128332 3300027907 Bacteria 1941
120 Ga0268266_10687983 3300028379 Bacteria 985
121 Ga0268264_10092323 3300028381 Unclassified 2613
122 Ga0265327_10000017 3300031251 Bacteria 445264
123 Ga0395899_0042198 3300037312 Unclassified 3406
124 Ga0395900_0150398 3300037418 Bacteria 2378
125 Ga0395898_0007540 3300037466 Bacteria 11555
126 Ga0395901_0015000 3300038443 Bacteria 7876
127 Ga0466963_0371199 3300044694 Bacteria 1008
128 Ga0495582_0202001 3300046473 Bacteria 1135
129 Ga0495622_0000224 3300046557 Bacteria 44888
130 Ga0495658_0001326 3300046683 Bacteria 12983
131 Ga0495671_0098321 3300046692 Bacteria 1431
132 Ga0495671_0115417 3300046692 Bacteria 1311
133 Ga0495649_0000076 3300046694 Bacteria 84939
134 Ga0495600_0001852 3300046809 Bacteria 11863
135 Ga0501083_0372103 3300049744 Bacteria 929
136 Ga0501276_002169 3300049773 Unclassified 1375
137 nmdc:mga03683_515_c1 3300050489 Bacteria 11084
138 nmdc:mga00v17_110923_c1 3300050491 Bacteria 1740
139 nmdc:mga00v17_641_c1 3300050491 Bacteria 19342
140 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
141 nmdc:mga0yw44_69441_c1 3300050492 Unclassified 2182
142 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
143 nmdc:mga0k408_2684_c1 3300050493 Bacteria 9428
144 nmdc:mga0k408_28_c1 3300050493 Bacteria 92977
145 nmdc:mga0k408_34305_c2 3300050493 Bacteria 2521
146 nmdc:mga0k408_4182_c1 3300050493 Bacteria 2107
147 nmdc:mga0k408_658_c1 3300050493 Bacteria 18912
148 nmdc:mga06z11_45_c1 3300050494 Bacteria 52129
149 nmdc:mga07m45_12662_c1 3300050496 Bacteria 4462
150 nmdc:mga0qj67_13954_c1 3300050509 Bacteria 6067
151 nmdc:mga08y16_2045_c1 3300050511 Bacteria 20668
152 nmdc:mga0sz30_140970_c1 3300050516 Unclassified 1064
153 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
154 nmdc:mga0sz30_4_c2 3300050516 Bacteria 152717
155 Ga0500610_0002923 3300053079 Bacteria 6433
156 Ga0500644_0000820 3300053088 Bacteria 10499
157 Ga0500644_0000872 3300053088 Bacteria 9872
158 Ga0500583_0000158 3300053092 Bacteria 28080
159 Ga0500566_0000001 3300053094 Bacteria 1101031
160 Ga0500555_000001 3300053103 Bacteria 1353713
161 Ga0500562_000002 3300053108 Bacteria 977234
162 Ga0500594_0000098 3300053118 Bacteria 25544
163 Ga0500628_000048 3300053129 Bacteria 42050
164 Ga0500642_0027649 3300053130 Bacteria 2331
165 Ga0500559_0012402 3300053136 Bacteria 3623
166 Ga0500561_0000001 3300053137 Bacteria 957685
167 Ga0500577_0005357 3300053142 Bacteria 3452
168 Ga0500589_000002 3300053147 Bacteria 245055
169 Ga0500611_000636 3300053727 Bacteria 3568

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025903 Ga0207680_10120819 Ga0207680_101208192 219
2 3300006051 Ga0075364_10097009 Ga0075364_100970094 238
3 3300006195 Ga0075366_10103352 Ga0075366_101033521 238
4 3300005563 Ga0068855_100003406 Ga0068855_1000034066 241
5 3300006195 Ga0075366_10000113 Ga0075366_100001135 241
6 3300025932 Ga0207690_10000643 Ga0207690_100006434 241
7 3300025949 Ga0207667_10003465 Ga0207667_1000346516 241
8 3300046692 Ga0495671_0115417 Ga0495671_0115417_60_794 243
9 3300053130 Ga0500642_0027649 Ga0500642_0027649_1565_2305 245
10 3300006195 Ga0075366_10047239 Ga0075366_100472392 250
11 3300050493 nmdc:mga0k408_34305_c2 nmdc:mga0k408_34305_c2_1174_1962 250
12 3300025909 Ga0207705_10166080 Ga0207705_101660802 254
13 3300005335 Ga0070666_10012370 Ga0070666_100123704 261
14 3300005367 Ga0070667_100000001 Ga0070667_1000000011009 261
15 3300005530 Ga0070679_100014676 Ga0070679_1000146763 261
16 3300005539 Ga0068853_100071467 Ga0068853_1000714674 261
17 3300005843 Ga0068860_100003949 Ga0068860_10000394914 261
18 3300006038 Ga0075365_10000031 Ga0075365_100000318 261
19 3300006353 Ga0075370_10060734 Ga0075370_100607343 261
20 3300013105 Ga0157369_10149673 Ga0157369_101496732 261
21 3300025903 Ga0207680_10014894 Ga0207680_100148943 261
22 3300025921 Ga0207652_10003866 Ga0207652_100038663 261
23 3300025986 Ga0207658_10000003 Ga0207658_10000003372 261
24 3300026041 Ga0207639_10041499 Ga0207639_100414994 261
25 3300028379 Ga0268266_10687983 Ga0268266_106879831 261
26 3300028381 Ga0268264_10092323 Ga0268264_100923231 261
27 3300050492 nmdc:mga0yw44_2_c1 nmdc:mga0yw44_2_c1_520962_521747 261
28 3300050496 nmdc:mga07m45_12662_c1 nmdc:mga07m45_12662_c1_648_1433 261
29 3300005327 Ga0070658_10468702 Ga0070658_104687022 262
30 3300005330 Ga0070690_100016558 Ga0070690_1000165584 262
31 3300005340 Ga0070689_100584023 Ga0070689_1005840231 262
32 3300005367 Ga0070667_100017107 Ga0070667_1000171074 262
33 3300005456 Ga0070678_100003651 Ga0070678_10000365112 262
34 3300005544 Ga0070686_100052922 Ga0070686_1000529221 262
35 3300005843 Ga0068860_100721437 Ga0068860_1007214372 262
36 3300005937 Ga0081455_10000003 Ga0081455_10000003109 262
37 3300009098 Ga0105245_10000001 Ga0105245_10000001149 262
38 3300009174 Ga0105241_10003398 Ga0105241_1000339813 262
39 3300013105 Ga0157369_10047242 Ga0157369_100472426 262
40 3300025911 Ga0207654_10005499 Ga0207654_100054997 262
41 3300025927 Ga0207687_10000004 Ga0207687_10000004118 262
42 3300025986 Ga0207658_10028229 Ga0207658_100282293 262
43 3300026121 Ga0207683_10044335 Ga0207683_100443354 262
44 3300031251 Ga0265327_10000017 Ga0265327_10000017389 262
45 3300053088 Ga0500644_0000872 Ga0500644_0000872_6012_6800 262
46 3300053118 Ga0500594_0000098 Ga0500594_0000098_678_1466 262
47 3300053129 Ga0500628_000048 Ga0500628_000048_4867_5655 262
48 3300005577 Ga0068857_100231682 Ga0068857_1002316822 263
49 3300006186 Ga0075369_10000002 Ga0075369_10000002147 263
50 3300006846 Ga0075430_100010775 Ga0075430_1000107756 263
51 3300009094 Ga0111539_10016317 Ga0111539_100163175 263
52 3300013296 Ga0157374_10112712 Ga0157374_101127123 263
53 3300026116 Ga0207674_10057011 Ga0207674_100570111 263
54 3300027907 Ga0207428_10128332 Ga0207428_101283323 263
55 3300037312 Ga0395899_0042198 Ga0395899_0042198_31_825 263
56 3300037418 Ga0395900_0150398 Ga0395900_0150398_466_1260 263
57 3300037466 Ga0395898_0007540 Ga0395898_0007540_4719_5513 263
58 3300038443 Ga0395901_0015000 Ga0395901_0015000_715_1509 263
59 3300046473 Ga0495582_0202001 Ga0495582_0202001_270_1070 263
60 3300046557 Ga0495622_0000224 Ga0495622_0000224_30767_31567 263
61 3300046683 Ga0495658_0001326 Ga0495658_0001326_4479_5279 263
62 3300046692 Ga0495671_0098321 Ga0495671_0098321_36_830 263
63 3300046809 Ga0495600_0001852 Ga0495600_0001852_232_1032 263
64 3300050509 nmdc:mga0qj67_13954_c1 nmdc:mga0qj67_13954_c1_2470_3261 263
65 3300050511 nmdc:mga08y16_2045_c1 nmdc:mga08y16_2045_c1_5618_6409 263
66 3300050516 nmdc:mga0sz30_1_c1 nmdc:mga0sz30_1_c1_644594_645388 263
67 3300053079 Ga0500610_0002923 Ga0500610_0002923_1079_1873 263
68 3300053088 Ga0500644_0000820 Ga0500644_0000820_2125_2919 263
69 3300053092 Ga0500583_0000158 Ga0500583_0000158_12300_13094 263
70 3300053094 Ga0500566_0000001 Ga0500566_0000001_878091_878891 263
71 3300053136 Ga0500559_0012402 Ga0500559_0012402_2484_3284 263
72 3300053142 Ga0500577_0005357 Ga0500577_0005357_1250_2044 263
73 3300053147 Ga0500589_000002 Ga0500589_000002_13727_14521 263
74 3300053727 Ga0500611_000636 Ga0500611_000636_2092_2886 263
75 3300001990 JGI24737J22298_10000007 JGI24737J22298_1000000728 264
76 3300002067 JGI24735J21928_10000034 JGI24735J21928_1000003419 264
77 3300003320 rootH2_10123135 rootH2_101231354 264
78 3300003322 rootL2_10295348 rootL2_102953483 264
79 3300003323 rootH1_10186764 rootH1_101867643 264
80 3300006177 Ga0075362_10000533 Ga0075362_1000053313 264
81 3300006186 Ga0075369_10000015 Ga0075369_1000001567 264
82 3300006195 Ga0075366_10000001 Ga0075366_10000001155 264
83 3300009553 Ga0105249_10000281 Ga0105249_1000028116 264
84 3300025961 Ga0207712_10000971 Ga0207712_1000097114 264
85 3300049744 Ga0501083_0372103 Ga0501083_0372103_69_863 264
86 3300050489 nmdc:mga03683_515_c1 nmdc:mga03683_515_c1_7645_8439 264
87 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_922845_923648 264
88 3300050516 nmdc:mga0sz30_4_c2 nmdc:mga0sz30_4_c2_78723_79526 264
89 3300053137 Ga0500561_0000001 Ga0500561_0000001_211665_212459 264
90 3300005335 Ga0070666_10026666 Ga0070666_100266664 265
91 3300005355 Ga0070671_100000001 Ga0070671_100000001230 265
92 3300005441 Ga0070700_100043599 Ga0070700_1000435992 265
93 3300005535 Ga0070684_100261707 Ga0070684_1002617071 265
94 3300006051 Ga0075364_10023441 Ga0075364_100234412 265
95 3300006195 Ga0075366_10000050 Ga0075366_1000005036 265
96 3300013100 Ga0157373_10022900 Ga0157373_100229004 265
97 3300013307 Ga0157372_10004952 Ga0157372_1000495215 265
98 3300025931 Ga0207644_10000001 Ga0207644_100000011207 265
99 3300050493 nmdc:mga0k408_28_c1 nmdc:mga0k408_28_c1_86394_87191 265
100 3300005329 Ga0070683_100000687 Ga0070683_10000068713 266
101 3300005535 Ga0070684_100000982 Ga0070684_10000098211 266
102 3300006038 Ga0075365_10006167 Ga0075365_1000616711 266
103 3300006038 Ga0075365_10128945 Ga0075365_101289451 266
104 3300006051 Ga0075364_10000634 Ga0075364_1000063419 266
105 3300013296 Ga0157374_10003375 Ga0157374_100033757 266
106 3300025944 Ga0207661_10000029 Ga0207661_10000029172 266
107 3300050491 nmdc:mga00v17_110923_c1 nmdc:mga00v17_110923_c1_550_1350 266
108 3300050491 nmdc:mga00v17_641_c1 nmdc:mga00v17_641_c1_3295_4098 266
109 3300050492 nmdc:mga0yw44_69441_c1 nmdc:mga0yw44_69441_c1_1356_2156 266
110 3300050493 nmdc:mga0k408_4182_c1 nmdc:mga0k408_4182_c1_567_1367 266
111 3300005563 Ga0068855_100000003 Ga0068855_100000003500 267
112 3300005563 Ga0068855_100224511 Ga0068855_1002245112 267
113 3300006195 Ga0075366_10001300 Ga0075366_100013006 267
114 3300009174 Ga0105241_10000007 Ga0105241_10000007165 267
115 3300013105 Ga0157369_10000643 Ga0157369_1000064327 267
116 3300025911 Ga0207654_10000002 Ga0207654_100000021381 267
117 3300025949 Ga0207667_10000008 Ga0207667_10000008491 267
118 3300025949 Ga0207667_10390002 Ga0207667_103900022 267
119 3300044694 Ga0466963_0371199 Ga0466963_0371199_124_927 267
120 3300050493 nmdc:mga0k408_658_c1 nmdc:mga0k408_658_c1_15267_16070 267
121 3300053103 Ga0500555_000001 Ga0500555_000001_1145961_1146764 267
122 3300002244 JGI24742J22300_10000005 JGI24742J22300_100000058 268
123 3300005328 Ga0070676_10010113 Ga0070676_100101133 268
124 3300005577 Ga0068857_100233882 Ga0068857_1002338822 268
125 3300009148 Ga0105243_10401982 Ga0105243_104019822 268
126 3300009993 Ga0105028_101313 Ga0105028_1013131 268
127 3300014325 Ga0163163_10030694 Ga0163163_100306945 268
128 3300025907 Ga0207645_10015245 Ga0207645_100152454 268
129 3300025921 Ga0207652_10199542 Ga0207652_101995422 268
130 3300005327 Ga0070658_10001707 Ga0070658_1000170713 269
131 3300005329 Ga0070683_100000790 Ga0070683_10000079011 269
132 3300005339 Ga0070660_100000591 Ga0070660_10000059119 269
133 3300005341 Ga0070691_10004129 Ga0070691_100041295 269
134 3300005354 Ga0070675_100361242 Ga0070675_1003612422 269
135 3300005366 Ga0070659_100000841 Ga0070659_10000084119 269
136 3300005458 Ga0070681_10322158 Ga0070681_103221581 269
137 3300005535 Ga0070684_100003367 Ga0070684_10000336710 269
138 3300005535 Ga0070684_100168923 Ga0070684_1001689232 269
139 3300005577 Ga0068857_100000011 Ga0068857_10000001167 269
140 3300005614 Ga0068856_100003765 Ga0068856_1000037655 269
141 3300005616 Ga0068852_100073544 Ga0068852_1000735444 269
142 3300006178 Ga0075367_10001680 Ga0075367_100016805 269
143 3300009093 Ga0105240_10044959 Ga0105240_100449597 269
144 3300009174 Ga0105241_10030132 Ga0105241_100301324 269
145 3300009551 Ga0105238_10297044 Ga0105238_102970443 269
146 3300013100 Ga0157373_10000174 Ga0157373_1000017456 269
147 3300025909 Ga0207705_10011566 Ga0207705_100115664 269
148 3300025911 Ga0207654_10019339 Ga0207654_100193394 269
149 3300025912 Ga0207707_10280618 Ga0207707_102806182 269
150 3300025913 Ga0207695_10088871 Ga0207695_100888711 269
151 3300025919 Ga0207657_10000697 Ga0207657_100006978 269
152 3300025924 Ga0207694_10215150 Ga0207694_102151503 269
153 3300025944 Ga0207661_10002965 Ga0207661_100029652 269
154 3300026078 Ga0207702_10011559 Ga0207702_100115595 269
155 3300026116 Ga0207674_10000001 Ga0207674_10000001135 269
156 3300026142 Ga0207698_10456333 Ga0207698_104563331 269
157 3300050493 nmdc:mga0k408_2684_c1 nmdc:mga0k408_2684_c1_8551_9369 269
158 3300050494 nmdc:mga06z11_45_c1 nmdc:mga06z11_45_c1_48049_48867 269
159 3300053108 Ga0500562_000002 Ga0500562_000002_50984_51793 269
160 3300046694 Ga0495649_0000076 Ga0495649_0000076_66124_66972 270
161 3300001915 JGI24741J21665_1004980 JGI24741J21665_10049803 271
162 3300001979 JGI24740J21852_10011761 JGI24740J21852_100117614 271
163 3300003322 rootL2_10122815 rootL2_101228152 271
164 3300005347 Ga0070668_100669219 Ga0070668_1006692191 271
165 3300006186 Ga0075369_10150347 Ga0075369_101503472 271
166 3300006195 Ga0075366_10249143 Ga0075366_102491432 271
167 3300009986 Ga0105033_100149 Ga0105033_1001495 271
168 3300049773 Ga0501276_002169 Ga0501276_002169_542_1357 271
169 3300050516 nmdc:mga0sz30_140970_c1 nmdc:mga0sz30_140970_c1_160_975 271

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rss-assembly1.cif.gz_A crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima soaked with nadp 0.782 18 264
6efw-assembly1.cif.gz_A crystal structure of a yjef family protein from cryptococcus neoformans var. grubii serotype a 0.7532 16 264
3bgk-assembly1.cif.gz_A the crystal structure of hypothetic protein smu.573 from streptococcus mutans 0.7512 15 265
2r3b-assembly1.cif.gz_B crystal structure of a ribokinase-like superfamily protein (ef1790) from enterococcus faecalis v583 at 1.80 a resolution 0.746 1 264
3k5w-assembly1.cif.gz_A crystal structure of a carbohydrate kinase (yjef family)from helicobacter pylori 0.7188 1 264
ID Description Score Start End Superfamily
af_A0A1D6Q7M7_549_616_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8217 185 221 3.40.140.10
af_P32740_1_306_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8197 30 264 3.40.1190.20
af_Q94AF2_52_361_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8149 23 264 3.40.1190.20
af_F1Q575_38_328_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8074 16 264 3.40.1190.20
af_Q8IHS6_37_377_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.7997 23 251 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A7C3PDX9-F1-model_v4 Uncharacterized protein 0.9762 1 260
AF-A0A7T9K7R3-F1-model_v4 deleted 0.9733 6 265
AF-A0A3D3HAQ0-F1-model_v4 NAD(P)H-hydrate dehydratase 0.9727 1 266
AF-A0A258BKG9-F1-model_v4 Uncharacterized protein 0.9709 98 260
AF-A0A7T9F1M6-F1-model_v4 deleted 0.9698 1 259

Feature Viewer

pLDDT pTM Quality
93.72 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map