F252778

General Info

Members Datasets Scaffolds Average Seq Length
168 121 336 108

Family's Representative Sequence

Representative Sequence 3300025909|Ga0207705_10000057|Ga0207705_1000005735
Length 111
Sequence MDHKTVEDYILSMPNTRLDYPFGEGVAVYKTAEDKMYALISEAKDPLQLSLKVDPTLGKVLREKYETVMEGYHLNKKHWITIVLTGQLGWDEIKDLIYHSYLLVTGSELLK

Samples

Sample ID Description Type Environment
1 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
43 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
44 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
88 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
91 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
92 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
97 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
99 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
100 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
101 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
102 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
103 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
104 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
105 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
106 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
107 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
108 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
109 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
110 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
111 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
112 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
113 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
114 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
115 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
116 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
117 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
118 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
119 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
120 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
121 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.05
Nodule 0
Rhizoplane 0
Rhizosphere 79.76
Stem 0
Stem Tuber 0
Unclassified 27.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207705_10000057 3300025909 Bacteria 157369
2 rootL2_10188374 3300003322 Bacteria 3582
3 rootH1_10306408 3300003323 Unclassified 2525
4 Ga0070658_10000097 3300005327 Bacteria 77127
5 Ga0070658_10214340 3300005327 Bacteria 1627
6 Ga0070658_10657373 3300005327 Unclassified 909
7 Ga0070683_100083936 3300005329 Bacteria 2984
8 Ga0070680_101139652 3300005336 Unclassified 674
9 Ga0070660_100000158 3300005339 Bacteria 44096
10 Ga0070661_101681806 3300005344 Unclassified 537
11 Ga0070668_100084355 3300005347 Bacteria 2495
12 Ga0070668_100448810 3300005347 Unclassified 1108
13 Ga0070714_100000902 3300005435 Bacteria 21061
14 Ga0070700_100047933 3300005441 Bacteria 2646
15 Ga0070678_100002852 3300005456 Bacteria 9566
16 Ga0070685_10444914 3300005466 Unclassified 906
17 Ga0070679_100143244 3300005530 Bacteria 2369
18 Ga0070679_100736906 3300005530 Bacteria 928
19 Ga0068853_100952863 3300005539 Unclassified 825
20 Ga0070672_101611369 3300005543 Unclassified 582
21 Ga0068855_100126317 3300005563 Bacteria 2924
22 Ga0068855_100439188 3300005563 Bacteria 1425
23 Ga0068855_100515169 3300005563 Bacteria 1298
24 Ga0068855_100683170 3300005563 Bacteria 1100
25 Ga0068855_100940132 3300005563 Bacteria 911
26 Ga0070664_100863207 3300005564 Unclassified 848
27 Ga0068857_100105997 3300005577 Bacteria 2524
28 Ga0068857_100139571 3300005577 Bacteria 2190
29 Ga0068856_100012876 3300005614 Bacteria 8096
30 Ga0068856_100586162 3300005614 Bacteria 1136
31 Ga0068859_100753866 3300005617 Bacteria 1062
32 Ga0068859_100781681 3300005617 Bacteria 1043
33 Ga0068858_100009505 3300005842 Bacteria 9276
34 Ga0068860_101088323 3300005843 Unclassified 818
35 Ga0081539_10055660 3300005985 Unclassified 2199
36 Ga0075365_10001495 3300006038 Bacteria 10666
37 Ga0075363_100027567 3300006048 Unclassified 2914
38 Ga0075364_10031602 3300006051 Unclassified 3401
39 Ga0075364_10883982 3300006051 Unclassified 608
40 Ga0097621_100000130 3300006237 Bacteria 44188
41 Ga0075370_10152346 3300006353 Bacteria 1355
42 Ga0068871_100000006 3300006358 Bacteria 116822
43 Ga0075428_100017118 3300006844 Bacteria 8007
44 Ga0097620_100753799 3300006931 Bacteria 1062
45 Ga0097620_100781642 3300006931 Bacteria 1043
46 Ga0105240_11041492 3300009093 Bacteria 873
47 Ga0105245_10000007 3300009098 Bacteria 312285
48 Ga0105247_10085792 3300009101 Bacteria 1992
49 Ga0105243_11914209 3300009148 Unclassified 626
50 Ga0105241_10332008 3300009174 Bacteria 1315
51 Ga0105241_10759713 3300009174 Unclassified 890
52 Ga0105248_10047562 3300009177 Bacteria 4811
53 Ga0105248_10451388 3300009177 Unclassified 1449
54 Ga0105248_10686285 3300009177 Bacteria 1155
55 Ga0105248_10721339 3300009177 Unclassified 1125
56 Ga0105248_10835604 3300009177 Bacteria 1039
57 Ga0105237_10421486 3300009545 Bacteria 1340
58 Ga0105238_10000151 3300009551 Bacteria 76390
59 Ga0105249_11159844 3300009553 Unclassified 843
60 Ga0105032_104576 3300009979 Bacteria 1179
61 Ga0105030_105040 3300009987 Unclassified 1118
62 Ga0105028_100138 3300009993 Bacteria 7688
63 Ga0105239_13011388 3300010375 Bacteria 549
64 Ga0157373_10106657 3300013100 Bacteria 1970
65 Ga0157370_10021650 3300013104 Bacteria 6405
66 Ga0157370_11812565 3300013104 Unclassified 548
67 Ga0157374_10000014 3300013296 Bacteria 396846
68 Ga0157374_10670948 3300013296 Bacteria 1049
69 Ga0163162_10641512 3300013306 Bacteria 1186
70 Ga0157372_10015808 3300013307 Bacteria 8097
71 Ga0157372_10126953 3300013307 Unclassified 2933
72 Ga0157514_100187 3300013874 Unclassified 522
73 Ga0163163_11210700 3300014325 Bacteria 818
74 Ga0157377_11554296 3300014745 Unclassified 528
75 Ga0157379_10008360 3300014968 Bacteria 8993
76 Ga0157379_10501694 3300014968 Bacteria 1125
77 Ga0207710_10227502 3300025900 Bacteria 927
78 Ga0207647_10774914 3300025904 Unclassified 517
79 Ga0207705_10298704 3300025909 Unclassified 1235
80 Ga0207705_10716241 3300025909 Unclassified 778
81 Ga0207654_10197192 3300025911 Bacteria 1323
82 Ga0207671_10359579 3300025914 Bacteria 1155
83 Ga0207657_10003173 3300025919 Bacteria 17584
84 Ga0207652_10401528 3300025921 Bacteria 1237
85 Ga0207694_10001155 3300025924 Bacteria 22934
86 Ga0207687_10000008 3300025927 Bacteria 497738
87 Ga0207687_10093519 3300025927 Bacteria 2198
88 Ga0207664_10000161 3300025929 Bacteria 53847
89 Ga0207644_10339849 3300025931 Unclassified 1217
90 Ga0207709_11685780 3300025935 Unclassified 527
91 Ga0207691_11727737 3300025940 Unclassified 506
92 Ga0207711_10304395 3300025941 Unclassified 1471
93 Ga0207711_10745672 3300025941 Unclassified 913
94 Ga0207711_11022235 3300025941 Unclassified 766
95 Ga0207661_10554856 3300025944 Bacteria 1052
96 Ga0207667_10067606 3300025949 Unclassified 3722
97 Ga0207667_10184472 3300025949 Bacteria 2142
98 Ga0207667_11234797 3300025949 Unclassified 726
99 Ga0207667_12088173 3300025949 Bacteria 525
100 Ga0207658_10003627 3300025986 Bacteria 10904
101 Ga0207703_10006536 3300026035 Bacteria 9302
102 Ga0207708_10230185 3300026075 Bacteria 1488
103 Ga0207702_10015300 3300026078 Bacteria 6360
104 Ga0207702_10030978 3300026078 Bacteria 4458
105 Ga0207702_10618870 3300026078 Bacteria 1063
106 Ga0207641_10005128 3300026088 Bacteria 11221
107 Ga0207674_10121159 3300026116 Bacteria 2583
108 Ga0207674_10254422 3300026116 Bacteria 1703
109 Ga0207683_10004501 3300026121 Bacteria 12024
110 Ga0268266_11938779 3300028379 Unclassified 563
111 Ga0268264_11264581 3300028381 Unclassified 748
112 Ga0265318_10322999 3300028577 Unclassified 563
113 Ga0265338_10003103 3300028800 Bacteria 23792
114 Ga0265338_10032341 3300028800 Bacteria 5106
115 Ga0265338_10180592 3300028800 Bacteria 1609
116 Ga0265327_10020507 3300031251 Unclassified 4023
117 Ga0265327_10191014 3300031251 Bacteria 932
118 Ga0395899_0354303 3300037312 Bacteria 981
119 Ga0395899_0561680 3300037312 Unclassified 732
120 Ga0395900_0100414 3300037418 Bacteria 2973
121 Ga0395900_0184267 3300037418 Bacteria 2119
122 Ga0395900_0406114 3300037418 Unclassified 1325
123 Ga0395900_0436449 3300037418 Bacteria 1268
124 Ga0395898_0006785 3300037466 Bacteria 12186
125 Ga0395905_0016274 3300037471 Bacteria 7065
126 Ga0395901_0003777 3300038443 Bacteria 15254
127 Ga0395901_0100047 3300038443 Bacteria 3041
128 Ga0395901_0116419 3300038443 Bacteria 2807
129 Ga0439442_097693 3300042002 Bacteria 634
130 Ga0439446_0012052 3300042156 Unclassified 2358
131 Ga0466967_0608665 3300045976 Bacteria 1079
132 Ga0495588_0000322 3300046674 Bacteria 31828
133 Ga0495686_0542722 3300047472 Bacteria 608
134 Ga0501033_0016791 3300049570 Bacteria 5536
135 Ga0501034_0008367 3300049571 Bacteria 10937
136 Ga0501037_0050207 3300049573 Bacteria 3053
137 Ga0501047_0000024 3300049581 Bacteria 230397
138 Ga0501080_0000007 3300049742 Bacteria 135749
139 Ga0501035_0000005 3300049822 Bacteria 392980
140 Ga0501044_0017086 3300049823 Bacteria 7785
141 nmdc:mga03n38_15568_c1 3300050490 Unclassified 2938
142 nmdc:mga00v17_79_c1 3300050491 Bacteria 59101
143 nmdc:mga0yw44_468_c1 3300050492 Bacteria 14325
144 nmdc:mga07m45_24357_c1 3300050496 Bacteria 1305
145 Ga0500643_000009 3300053087 Bacteria 444150
146 Ga0500643_003678 3300053087 Bacteria 7232
147 Ga0500643_190201 3300053087 Bacteria 550
148 Ga0500646_0000253 3300053090 Bacteria 16386
149 Ga0500646_0226721 3300053090 Unclassified 650
150 Ga0500583_0002012 3300053092 Bacteria 5989
151 Ga0500651_0216093 3300053093 Bacteria 1126
152 Ga0500650_0000040 3300053098 Bacteria 48637
153 Ga0500555_000002 3300053103 Bacteria 1314346
154 Ga0500556_0000419 3300053104 Bacteria 30563
155 Ga0500562_006052 3300053108 Bacteria 3045
156 Ga0500594_0000001 3300053118 Bacteria 1178472
157 Ga0500594_0000246 3300053118 Bacteria 13106
158 Ga0500614_000001 3300053123 Bacteria 1274484
159 Ga0500628_000005 3300053129 Bacteria 201423
160 Ga0500628_027370 3300053129 Unclassified 1209
161 Ga0500652_000012 3300053131 Bacteria 155076
162 Ga0500655_007464 3300053133 Bacteria 1966
163 Ga0500577_0014083 3300053142 Bacteria 2462
164 Ga0500579_010419 3300053143 Bacteria 5924
165 Ga0500616_0292310 3300053153 Unclassified 680
166 Ga0500633_0000239 3300053160 Bacteria 7837
167 Ga0500649_000006 3300053722 Bacteria 116211
168 Ga0501084_1184924 3300054114 Bacteria 641
169 Ga0207705_10000057
170 rootL2_10188374
171 rootH1_10306408
172 Ga0070658_10000097
173 Ga0070658_10214340
174 Ga0070658_10657373
175 Ga0070683_100083936
176 Ga0070680_101139652
177 Ga0070660_100000158
178 Ga0070661_101681806
179 Ga0070668_100084355
180 Ga0070668_100448810
181 Ga0070714_100000902
182 Ga0070700_100047933
183 Ga0070678_100002852
184 Ga0070685_10444914
185 Ga0070679_100143244
186 Ga0070679_100736906
187 Ga0068853_100952863
188 Ga0070672_101611369
189 Ga0068855_100126317
190 Ga0068855_100439188
191 Ga0068855_100515169
192 Ga0068855_100683170
193 Ga0068855_100940132
194 Ga0070664_100863207
195 Ga0068857_100105997
196 Ga0068857_100139571
197 Ga0068856_100012876
198 Ga0068856_100586162
199 Ga0068859_100753866
200 Ga0068859_100781681
201 Ga0068858_100009505
202 Ga0068860_101088323
203 Ga0081539_10055660
204 Ga0075365_10001495
205 Ga0075363_100027567
206 Ga0075364_10031602
207 Ga0075364_10883982
208 Ga0097621_100000130
209 Ga0075370_10152346
210 Ga0068871_100000006
211 Ga0075428_100017118
212 Ga0097620_100753799
213 Ga0097620_100781642
214 Ga0105240_11041492
215 Ga0105245_10000007
216 Ga0105247_10085792
217 Ga0105243_11914209
218 Ga0105241_10332008
219 Ga0105241_10759713
220 Ga0105248_10047562
221 Ga0105248_10451388
222 Ga0105248_10686285
223 Ga0105248_10721339
224 Ga0105248_10835604
225 Ga0105237_10421486
226 Ga0105238_10000151
227 Ga0105249_11159844
228 Ga0105032_104576
229 Ga0105030_105040
230 Ga0105028_100138
231 Ga0105239_13011388
232 Ga0157373_10106657
233 Ga0157370_10021650
234 Ga0157370_11812565
235 Ga0157374_10000014
236 Ga0157374_10670948
237 Ga0163162_10641512
238 Ga0157372_10015808
239 Ga0157372_10126953
240 Ga0157514_100187
241 Ga0163163_11210700
242 Ga0157377_11554296
243 Ga0157379_10008360
244 Ga0157379_10501694
245 Ga0207710_10227502
246 Ga0207647_10774914
247 Ga0207705_10298704
248 Ga0207705_10716241
249 Ga0207654_10197192
250 Ga0207671_10359579
251 Ga0207657_10003173
252 Ga0207652_10401528
253 Ga0207694_10001155
254 Ga0207687_10000008
255 Ga0207687_10093519
256 Ga0207664_10000161
257 Ga0207644_10339849
258 Ga0207709_11685780
259 Ga0207691_11727737
260 Ga0207711_10304395
261 Ga0207711_10745672
262 Ga0207711_11022235
263 Ga0207661_10554856
264 Ga0207667_10067606
265 Ga0207667_10184472
266 Ga0207667_11234797
267 Ga0207667_12088173
268 Ga0207658_10003627
269 Ga0207703_10006536
270 Ga0207708_10230185
271 Ga0207702_10015300
272 Ga0207702_10030978
273 Ga0207702_10618870
274 Ga0207641_10005128
275 Ga0207674_10121159
276 Ga0207674_10254422
277 Ga0207683_10004501
278 Ga0268266_11938779
279 Ga0268264_11264581
280 Ga0265318_10322999
281 Ga0265338_10003103
282 Ga0265338_10032341
283 Ga0265338_10180592
284 Ga0265327_10020507
285 Ga0265327_10191014
286 Ga0395899_0354303
287 Ga0395899_0561680
288 Ga0395900_0100414
289 Ga0395900_0184267
290 Ga0395900_0406114
291 Ga0395900_0436449
292 Ga0395898_0006785
293 Ga0395905_0016274
294 Ga0395901_0003777
295 Ga0395901_0100047
296 Ga0395901_0116419
297 Ga0439442_097693
298 Ga0439446_0012052
299 Ga0466967_0608665
300 Ga0495588_0000322
301 Ga0495686_0542722
302 Ga0501033_0016791
303 Ga0501034_0008367
304 Ga0501037_0050207
305 Ga0501047_0000024
306 Ga0501080_0000007
307 Ga0501035_0000005
308 Ga0501044_0017086
309 nmdc:mga03n38_15568_c1
310 nmdc:mga00v17_79_c1
311 nmdc:mga0yw44_468_c1
312 nmdc:mga07m45_24357_c1
313 Ga0500643_000009
314 Ga0500643_003678
315 Ga0500643_190201
316 Ga0500646_0000253
317 Ga0500646_0226721
318 Ga0500583_0002012
319 Ga0500651_0216093
320 Ga0500650_0000040
321 Ga0500555_000002
322 Ga0500556_0000419
323 Ga0500562_006052
324 Ga0500594_0000001
325 Ga0500594_0000246
326 Ga0500614_000001
327 Ga0500628_000005
328 Ga0500628_027370
329 Ga0500652_000012
330 Ga0500655_007464
331 Ga0500577_0014083
332 Ga0500579_010419
333 Ga0500616_0292310
334 Ga0500633_0000239
335 Ga0500649_000006
336 Ga0501084_1184924

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04237

YjbR

YjbR

11

103

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.9302 4 107
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.8989 4 107
3h9x-assembly1.cif.gz_A crystal structure of the pspto_3016 protein from pseudomonas syringae, northeast structural genomics consortium target psr293 0.8424 1 102
2kfp-assembly1.cif.gz_A solution nmr structure of pspto_3016 from pseudomonas syringae. northeast structural genomics consortium target psr293. 0.8079 1 102
3h9x-assembly1.cif.gz_A crystal structure of the pspto_3016 protein from pseudomonas syringae, northeast structural genomics consortium target psr293 0.7995 1 102
ID Description Score Start End Superfamily
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.9302 4 107 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.9253 1 102 3.90.1150.30
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.9024 3 107 3.90.1150.30
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8989 4 107 3.90.1150.30
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8788 3 107 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A7W1KH19-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9847 1 102 GO:0003677
AF-A0A431HK12-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9805 1 103 GO:0003677
AF-A0A1F7RAR5-F1-model_v4 MmcQ-like protein 0.9741 13 102
AF-A0A2G6C2F8-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9737 13 105
AF-A0A7W0W8R6-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9722 4 103 GO:0003677

Map