F252533

General Info

Members Datasets Scaffolds Average Seq Length
168 117 336 398

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10164040|Ga0105240_101640402
Length 426
Sequence MRAPQAHASTGNVAQIKLEIPPFPRQVDPMSAVKKTIRVGYDLRVFFTDQVFEPANLVLKQAMTGERTGSIKKALLVFDESLAQTQPALAQQIELYFATHSDGLKLVCPPLVIEGGERTKNSDFHVSEIHSQIDRHHIDRHSYVVAVGGGALLDMAGFAAATAHRGIRHVRIPTTTLSQADSGVGVKNGINAFGKKNFIGTFAPPFAVINDFQLLDSLSPRDKRAGYVEAVKVALIRDRQFFEALERDAAALRDFEPEAMRRLIRRCAELHLEHIAASGDPFEFGAARPLDFGHWSAHKLEQLSEYQVRHGEAVAIGIALDVIYSRRMGFLDAASAGRALQLLETLGFELFASELLHVNSQSSLLVLDGLEEFREHLGGELTITLLREIGRSFEVHEMNLPKLVAALYELKERHDRNGQKIIRATA

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
43 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
44 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
45 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
46 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
47 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
48 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
49 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
50 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
51 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
52 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
53 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
54 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
55 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
56 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
57 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
58 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
59 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
60 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
61 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
62 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
63 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
64 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
65 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
66 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
67 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
68 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
69 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
70 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
71 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
72 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
73 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
74 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
75 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
76 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
77 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
78 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
79 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
80 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
81 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
82 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
83 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
84 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
85 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
86 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
87 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
88 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
89 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
90 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
101 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
102 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
103 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
104 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
105 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
108 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
110 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
111 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
112 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
113 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
114 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
115 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
116 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
117 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.81
Metatranscriptomes 0
Isolates 1.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.38
Rhizosphere 95.83
Stem 0
Stem Tuber 0
Unclassified 8.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10164040 3300009093 Bacteria 2637
2 rootH1_10047401 3300003323 Bacteria 2026
3 Ga0070683_100143137 3300005329 Bacteria 2265
4 Ga0070690_100039830 3300005330 Unclassified 2970
5 Ga0068869_100061279 3300005334 Bacteria 2759
6 Ga0070689_100203571 3300005340 Bacteria 1617
7 Ga0070671_100096748 3300005355 Unclassified 2476
8 Ga0070688_100175849 3300005365 Unclassified 1481
9 Ga0070709_10124777 3300005434 Bacteria 1750
10 Ga0070714_100003320 3300005435 Bacteria 11998
11 Ga0070708_100167709 3300005445 Bacteria 2049
12 Ga0070681_10129218 3300005458 Bacteria 2458
13 Ga0070681_10148270 3300005458 Bacteria 2273
14 Ga0070685_10011067 3300005466 Unclassified 4710
15 Ga0070706_100296868 3300005467 Bacteria 1508
16 Ga0070679_100143152 3300005530 Bacteria 2369
17 Ga0070684_100127441 3300005535 Unclassified 2294
18 Ga0070686_100001188 3300005544 Bacteria 14798
19 Ga0068855_100074687 3300005563 Bacteria 3936
20 Ga0068857_100018726 3300005577 Bacteria 6078
21 Ga0068857_100050496 3300005577 Bacteria 3690
22 Ga0081539_10001102 3300005985 Bacteria 49012
23 Ga0070717_10020893 3300006028 Bacteria 5154
24 Ga0097621_100023747 3300006237 Bacteria 4777
25 Ga0068871_100008572 3300006358 Bacteria 7349
26 Ga0068871_100045116 3300006358 Bacteria 3547
27 Ga0075428_100003861 3300006844 Bacteria 16462
28 Ga0099794_10009191 3300007265 Bacteria 4141
29 Ga0105240_10141653 3300009093 Bacteria 2874
30 Ga0111539_10011614 3300009094 Bacteria 11052
31 Ga0111539_10081085 3300009094 Bacteria 3816
32 Ga0111539_10119357 3300009094 Bacteria 3090
33 Ga0111539_10245374 3300009094 Bacteria 2085
34 Ga0105245_10055596 3300009098 Bacteria 3555
35 Ga0105245_10059472 3300009098 Bacteria 3441
36 Ga0114129_10124292 3300009147 Bacteria 3549
37 Ga0105242_10096080 3300009176 Bacteria 2502
38 Ga0105238_10207241 3300009551 Bacteria 1937
39 Ga0157374_10187093 3300013296 Bacteria 2025
40 Ga0157375_10000037 3300013308 Bacteria 176523
41 Ga0163163_10000336 3300014325 Bacteria 45265
42 Ga0163163_10069026 3300014325 Unclassified 3518
43 Ga0157376_10029656 3300014969 Bacteria 4360
44 Ga0157376_10061902 3300014969 Bacteria 3147
45 Ga0207707_10107187 3300025912 Bacteria 2443
46 Ga0207695_10178066 3300025913 Bacteria 2048
47 Ga0207664_10003827 3300025929 Bacteria 10104
48 Ga0207644_10078967 3300025931 Unclassified 2427
49 Ga0207670_10027290 3300025936 Bacteria 3608
50 Ga0207670_10167894 3300025936 Unclassified 1643
51 Ga0207676_10179458 3300026095 Unclassified 1853
52 Ga0207674_10096104 3300026116 Bacteria 2948
53 Ga0265319_1000051 3300028563 Bacteria 97169
54 Ga0265338_10007456 3300028800 Bacteria 13572
55 Ga0265338_10014861 3300028800 Bacteria 8611
56 Ga0265338_10022406 3300028800 Bacteria 6540
57 Ga0265338_10050686 3300028800 Bacteria 3748
58 Ga0265338_10062416 3300028800 Bacteria 3256
59 Ga0265324_10011380 3300029957 Bacteria 3390
60 Ga0265332_10021859 3300031238 Bacteria 2825
61 Ga0265320_10049565 3300031240 Bacteria 2044
62 Ga0265329_10001632 3300031242 Bacteria 10755
63 Ga0265327_10001437 3300031251 Bacteria 30049
64 Ga0265316_10002213 3300031344 Bacteria 20414
65 Ga0307408_100000063 3300031548 Bacteria 125218
66 Ga0307408_100002409 3300031548 Bacteria 13171
67 Ga0265313_10002179 3300031595 Bacteria 17376
68 Ga0265314_10000340 3300031711 Bacteria 65215
69 Ga0307406_10001930 3300031901 Bacteria 11308
70 Ga0307406_10108328 3300031901 Bacteria 1907
71 Ga0373956_0023007 3300035119 Bacteria 2671
72 Ga0373937_0075743 3300036401 Bacteria 3107
73 Ga0373925_0102703 3300037068 Bacteria 2200
74 Ga0395905_0242341 3300037471 Bacteria 1685
75 Ga0439449_0042435 3300042007 Unclassified 1690
76 Ga0466969_0005030 3300044656 Bacteria 7034
77 Ga0466972_0010917 3300044658 Bacteria 4557
78 Ga0466961_0006759 3300044693 Bacteria 7299
79 Ga0453684_0000019 3300044712 Bacteria 908702
80 Ga0466968_0025424 3300044735 Bacteria 2425
81 Ga0466970_0084507 3300044765 Unclassified 1718
82 Ga0466960_0005317 3300044901 Bacteria 5091
83 Ga0466959_0039593 3300045049 Unclassified 3483
84 Ga0451576_0047288 3300045051 Bacteria 4524
85 Ga0451576_0113487 3300045051 Bacteria 2821
86 Ga0451576_0118117 3300045051 Bacteria 2761
87 Ga0451576_0274042 3300045051 Bacteria 1764
88 Ga0466967_0364687 3300045976 Unclassified 1400
89 Ga0495592_0000108 3300046454 Bacteria 74029
90 Ga0495592_0036222 3300046454 Bacteria 3717
91 Ga0495618_0002097 3300046514 Bacteria 13061
92 Ga0495628_0000042 3300046516 Bacteria 102062
93 Ga0495630_0004967 3300046517 Bacteria 9354
94 Ga0495666_0054560 3300046526 Bacteria 1916
95 Ga0495652_0132282 3300046529 Bacteria 1973
96 Ga0495640_0029404 3300046533 Bacteria 3946
97 Ga0495640_0031867 3300046533 Bacteria 3760
98 Ga0495586_0000387 3300046535 Bacteria 27000
99 Ga0495645_0021429 3300046543 Bacteria 4670
100 Ga0495657_0120945 3300046675 Bacteria 1649
101 Ga0495599_0007307 3300046678 Bacteria 6693
102 Ga0495658_0036562 3300046683 Bacteria 2710
103 Ga0495613_0072732 3300046689 Bacteria 2506
104 Ga0495613_0089280 3300046689 Bacteria 2233
105 Ga0495581_0057104 3300047315 Bacteria 2253
106 Ga0495674_0009004 3300047319 Bacteria 9485
107 Ga0495676_0069821 3300047321 Bacteria 2709
108 Ga0495686_0053591 3300047472 Bacteria 2527
109 Ga0496104_0146680 3300048907 Bacteria 2266
110 Ga0496112_0142025 3300048915 Bacteria 2370
111 Ga0496115_0009314 3300048918 Bacteria 7296
112 Ga0496115_0028929 3300048918 Bacteria 4347
113 Ga0496116_0007981 3300048919 Bacteria 9269
114 Ga0501033_0012152 3300049570 Bacteria 6572
115 Ga0501033_0047737 3300049570 Bacteria 3183
116 Ga0501034_0014405 3300049571 Bacteria 8144
117 Ga0501034_0015050 3300049571 Bacteria 7954
118 Ga0501034_0029214 3300049571 Bacteria 5604
119 Ga0501034_0051112 3300049571 Bacteria 4168
120 Ga0501034_0084193 3300049571 Bacteria 3182
121 Ga0501036_0019390 3300049572 Bacteria 5709
122 Ga0501036_0065786 3300049572 Bacteria 3067
123 Ga0501036_0287580 3300049572 Bacteria 1375
124 Ga0501037_0056552 3300049573 Bacteria 2864
125 Ga0501038_0053281 3300049574 Bacteria 3483
126 Ga0501038_0179684 3300049574 Bacteria 1708
127 Ga0501039_0027574 3300049575 Bacteria 4367
128 Ga0501039_0027802 3300049575 Bacteria 4349
129 Ga0501039_0072853 3300049575 Bacteria 2669
130 Ga0501043_0016551 3300049579 Bacteria 5780
131 Ga0501043_0236881 3300049579 Bacteria 1408
132 Ga0501046_0001414 3300049580 Bacteria 23087
133 Ga0501046_0207042 3300049580 Bacteria 1457
134 Ga0501046_0224545 3300049580 Bacteria 1389
135 Ga0501047_0002835 3300049581 Bacteria 16434
136 Ga0501047_0003713 3300049581 Bacteria 14373
137 Ga0501047_0013781 3300049581 Bacteria 7678
138 Ga0501048_0026929 3300049582 Bacteria 4183
139 Ga0501067_0007474 3300049583 Bacteria 6070
140 Ga0501068_0019047 3300049584 Bacteria 3978
141 Ga0501070_0061916 3300049586 Bacteria 3100
142 Ga0501072_0086438 3300049588 Bacteria 2488
143 Ga0501073_0033915 3300049589 Bacteria 3633
144 Ga0501073_0258172 3300049589 Bacteria 1202
145 Ga0501074_0024864 3300049590 Bacteria 4351
146 Ga0501080_0079469 3300049742 Bacteria 3049
147 Ga0501080_0098841 3300049742 Bacteria 2708
148 Ga0501080_0175220 3300049742 Bacteria 1976
149 Ga0501083_0023395 3300049744 Bacteria 4285
150 Ga0501083_0107792 3300049744 Bacteria 1833
151 Ga0501035_0007819 3300049822 Bacteria 9991
152 Ga0501035_0123700 3300049822 Bacteria 2259
153 Ga0501044_0032924 3300049823 Bacteria 5448
154 Ga0501044_0302907 3300049823 Unclassified 1527
155 nmdc:mga05p37_156693_c1 3300050507 Bacteria 2782
156 nmdc:mga08y16_104847_c1 3300050511 Bacteria 2943
157 nmdc:mga08y16_154670_c1 3300050511 Bacteria 2383
158 nmdc:mga08y16_230779_c1 3300050511 Bacteria 1914
159 nmdc:mga08y16_49739_c1 3300050511 Bacteria 4386
160 nmdc:mga08y16_95839_c1 3300050511 Bacteria 3090
161 nmdc:mga0rr50_332113_c1 3300050513 Bacteria 1276
162 Ga0495601_0027033 3300053077 Bacteria 3546
163 Ga0501084_0011169 3300054114 Bacteria 7438
164 Ga0501084_0043825 3300054114 Bacteria 3743
165 Ga0501082_0012143 3300060353 Bacteria 7400
166 Ga0501082_0274443 3300060353 Bacteria 1467
167 2911143580 2911138879 Bacteria 5811561
168 3003236417 3003233435 Bacteria 4458031
169 Ga0105240_10164040
170 rootH1_10047401
171 Ga0070683_100143137
172 Ga0070690_100039830
173 Ga0068869_100061279
174 Ga0070689_100203571
175 Ga0070671_100096748
176 Ga0070688_100175849
177 Ga0070709_10124777
178 Ga0070714_100003320
179 Ga0070708_100167709
180 Ga0070681_10129218
181 Ga0070681_10148270
182 Ga0070685_10011067
183 Ga0070706_100296868
184 Ga0070679_100143152
185 Ga0070684_100127441
186 Ga0070686_100001188
187 Ga0068855_100074687
188 Ga0068857_100018726
189 Ga0068857_100050496
190 Ga0081539_10001102
191 Ga0070717_10020893
192 Ga0097621_100023747
193 Ga0068871_100008572
194 Ga0068871_100045116
195 Ga0075428_100003861
196 Ga0099794_10009191
197 Ga0105240_10141653
198 Ga0111539_10011614
199 Ga0111539_10081085
200 Ga0111539_10119357
201 Ga0111539_10245374
202 Ga0105245_10055596
203 Ga0105245_10059472
204 Ga0114129_10124292
205 Ga0105242_10096080
206 Ga0105238_10207241
207 Ga0157374_10187093
208 Ga0157375_10000037
209 Ga0163163_10000336
210 Ga0163163_10069026
211 Ga0157376_10029656
212 Ga0157376_10061902
213 Ga0207707_10107187
214 Ga0207695_10178066
215 Ga0207664_10003827
216 Ga0207644_10078967
217 Ga0207670_10027290
218 Ga0207670_10167894
219 Ga0207676_10179458
220 Ga0207674_10096104
221 Ga0265319_1000051
222 Ga0265338_10007456
223 Ga0265338_10014861
224 Ga0265338_10022406
225 Ga0265338_10050686
226 Ga0265338_10062416
227 Ga0265324_10011380
228 Ga0265332_10021859
229 Ga0265320_10049565
230 Ga0265329_10001632
231 Ga0265327_10001437
232 Ga0265316_10002213
233 Ga0307408_100000063
234 Ga0307408_100002409
235 Ga0265313_10002179
236 Ga0265314_10000340
237 Ga0307406_10001930
238 Ga0307406_10108328
239 Ga0373956_0023007
240 Ga0373937_0075743
241 Ga0373925_0102703
242 Ga0395905_0242341
243 Ga0439449_0042435
244 Ga0466969_0005030
245 Ga0466972_0010917
246 Ga0466961_0006759
247 Ga0453684_0000019
248 Ga0466968_0025424
249 Ga0466970_0084507
250 Ga0466960_0005317
251 Ga0466959_0039593
252 Ga0451576_0047288
253 Ga0451576_0113487
254 Ga0451576_0118117
255 Ga0451576_0274042
256 Ga0466967_0364687
257 Ga0495592_0000108
258 Ga0495592_0036222
259 Ga0495618_0002097
260 Ga0495628_0000042
261 Ga0495630_0004967
262 Ga0495666_0054560
263 Ga0495652_0132282
264 Ga0495640_0029404
265 Ga0495640_0031867
266 Ga0495586_0000387
267 Ga0495645_0021429
268 Ga0495657_0120945
269 Ga0495599_0007307
270 Ga0495658_0036562
271 Ga0495613_0072732
272 Ga0495613_0089280
273 Ga0495581_0057104
274 Ga0495674_0009004
275 Ga0495676_0069821
276 Ga0495686_0053591
277 Ga0496104_0146680
278 Ga0496112_0142025
279 Ga0496115_0009314
280 Ga0496115_0028929
281 Ga0496116_0007981
282 Ga0501033_0012152
283 Ga0501033_0047737
284 Ga0501034_0014405
285 Ga0501034_0015050
286 Ga0501034_0029214
287 Ga0501034_0051112
288 Ga0501034_0084193
289 Ga0501036_0019390
290 Ga0501036_0065786
291 Ga0501036_0287580
292 Ga0501037_0056552
293 Ga0501038_0053281
294 Ga0501038_0179684
295 Ga0501039_0027574
296 Ga0501039_0027802
297 Ga0501039_0072853
298 Ga0501043_0016551
299 Ga0501043_0236881
300 Ga0501046_0001414
301 Ga0501046_0207042
302 Ga0501046_0224545
303 Ga0501047_0002835
304 Ga0501047_0003713
305 Ga0501047_0013781
306 Ga0501048_0026929
307 Ga0501067_0007474
308 Ga0501068_0019047
309 Ga0501070_0061916
310 Ga0501072_0086438
311 Ga0501073_0033915
312 Ga0501073_0258172
313 Ga0501074_0024864
314 Ga0501080_0079469
315 Ga0501080_0098841
316 Ga0501080_0175220
317 Ga0501083_0023395
318 Ga0501083_0107792
319 Ga0501035_0007819
320 Ga0501035_0123700
321 Ga0501044_0032924
322 Ga0501044_0302907
323 nmdc:mga05p37_156693_c1
324 nmdc:mga08y16_104847_c1
325 nmdc:mga08y16_154670_c1
326 nmdc:mga08y16_230779_c1
327 nmdc:mga08y16_49739_c1
328 nmdc:mga08y16_95839_c1
329 nmdc:mga0rr50_332113_c1
330 Ga0495601_0027033
331 Ga0501084_0011169
332 Ga0501084_0043825
333 Ga0501082_0012143
334 Ga0501082_0274443
335 2911143580
336 3003236417

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01761

DHQ_synthase

3-dehydroquinate synthase

110

225

0.96

PF24621

226

368

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3okf-assembly1.cif.gz_A 2.5 angstrom resolution crystal structure of 3-dehydroquinate synthase (arob) from vibrio cholerae 0.9111 16 378
3okf-assembly1.cif.gz_B 2.5 angstrom resolution crystal structure of 3-dehydroquinate synthase (arob) from vibrio cholerae 0.9103 31 378
6lk2-assembly1.cif.gz_C crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+, nad and chlorogenic acid 0.9089 18 374
6lk2-assembly2.cif.gz_D crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+, nad and chlorogenic acid 0.9062 18 374
5eks-assembly3.cif.gz_A structure of 3-dehydroquinate synthase from acinetobacter baumannii in complex with nad 0.9059 26 379
ID Description Score Start End Superfamily
3okfB02 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.9172 192 378 1.20.1090.10
af_A0A1D6IPW7_249_439_1.20.1090.10 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.9056 192 380 1.20.1090.10
3okfB02 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.8978 192 378 1.20.1090.10
af_A0A1D6IPW7_249_439_1.20.1090.10 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.8922 192 380 1.20.1090.10
5hvnA02 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.8852 192 377 1.20.1090.10
ID Description Score Start End GO Terms
AF-A0A357THT0-F1-model_v4 3-dehydroquinate synthase 0.9662 4 290 GO:0003856
GO:0009073
AF-A0A7V4H262-F1-model_v4 3-dehydroquinate synthase (EC 4.2.3.4) 0.9634 1 326 GO:0003856
GO:0009073
AF-A0A4Q3PVI8-F1-model_v4 deleted 0.9632 4 245
AF-B9M9B5-F1-model_v4 3-dehydroquinate synthase 0.9598 3 383 GO:0003856
GO:0009073
AF-A0A1U9NFZ2-F1-model_v4 3-dehydroquinate synthase 0.9588 4 380 GO:0003856
GO:0009073

Map