F251294

General Info

Members Datasets Scaffolds Average Seq Length
167 76 330 312

Family's Representative Sequence

Representative Sequence 3300048927|Ga0496124_0002013|Ga0496124_0002013_22481_23554
Length 357
Sequence MRVSTKSLPRSKSNWMPGLPHNNANAIQPVQAQKEPVGWRSQQVLFSPGKVVDYVAKNRWKRFAPLLLLMLPGLLYLLINNYLPMFGMIIAFKDINFAKGIFGSDWIGFKNFEYLFKTSDAFIITRNTLLYNGAFIIVNTLGAITIAILLNEIRAKLYQRFYQSVVILPHLISMVIVSYLVFAMLSSDSGLLNKSILPLLGLEEISWYSSKEYWPYILTTVNIWKGIGFLSVIYLASIISIDPEYYEAATLDGASKWQQIRKITVPLIMPVITIMTLLAIGRIFYSDFGLFYQVPMDSGILSDTTSVIDTYVYRALMNLGDIGMSSAAGVYQSIVGFVLVILSNYTVRKFNKENALF

Samples

Sample ID Description Type Environment
1 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
4 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
5 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
6 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
7 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
8 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
9 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
10 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
11 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
12 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
13 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
14 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
15 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
16 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
17 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
18 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
19 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
20 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
21 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
22 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
23 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
24 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
25 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
27 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
28 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
29 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
30 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
31 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
32 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
33 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
34 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
35 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
36 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
37 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
38 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
39 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
40 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
41 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
42 2818991459 Paenibacillus sp. 597 Isolate Unclassified
43 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
44 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
45 2857472729 Cohnella sp. R-74144 Isolate Unclassified
46 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
47 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
48 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
49 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
50 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
51 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
52 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
53 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
54 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
55 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
56 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
57 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
58 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
59 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
60 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
61 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
62 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
63 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
64 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
65 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
66 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
67 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
68 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
69 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
70 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
71 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified
72 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
73 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
74 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
75 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
76 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 43.11
Metatranscriptomes 0.6
Isolates 56.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.78
Nodule 2.4
Rhizoplane 0.6
Rhizosphere 40.12
Stem 0
Stem Tuber 0
Unclassified 2.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496124_0002013 3300048927 Bacteria 27672
2 JGI25162J39368_1008350 3300002737 Bacteria 1494
3 Ga0055541_1000605 3300003841 Bacteria 9562
4 Ga0055541_1003236 3300003841 Bacteria 3089
5 Ga0055541_1009498 3300003841 Bacteria 1500
6 Ga0055541_1011150 3300003841 Bacteria 1327
7 Ga0105244_10003918 3300009036 Bacteria 10466
8 Ga0105244_10011579 3300009036 Bacteria 5274
9 Ga0209566_100022 3300025225 Bacteria 403259
10 Ga0209566_100054 3300025225 Bacteria 221422
11 Ga0209566_100111 3300025225 Bacteria 111965
12 Ga0209566_103898 3300025225 Bacteria 2146
13 Ga0209437_100726 3300025233 Bacteria 16731
14 Ga0209675_1004801 3300025291 Bacteria 5871
15 Ga0207655_1040044 3300025728 Bacteria 2028
16 Ga0307409_100063916 3300031995 Bacteria 2889
17 Ga0307409_100065394 3300031995 Bacteria 2861
18 Ga0307416_100025431 3300032002 Bacteria 4339
19 Ga0395899_0009850 3300037312 Bacteria 7330
20 Ga0395899_0039748 3300037312 Bacteria 3520
21 Ga0395899_0186570 3300037312 Bacteria 1453
22 Ga0439449_0000507 3300042007 Bacteria 14574
23 Ga0439449_0059819 3300042007 Bacteria 1406
24 Ga0453683_0017050 3300044673 Unclassified 4682
25 Ga0453684_0569819 3300044712 Bacteria 1245
26 Ga0495637_0058296 3300046520 Bacteria 1592
27 Ga0495660_0039931 3300046810 Bacteria 2603
28 Ga0496112_0067948 3300048915 Bacteria 3519
29 Ga0496116_0002088 3300048919 Bacteria 21362
30 Ga0496116_0005247 3300048919 Bacteria 12109
31 Ga0496116_0009006 3300048919 Bacteria 8576
32 Ga0496116_0011552 3300048919 Bacteria 7293
33 Ga0496116_0016700 3300048919 Bacteria 5733
34 Ga0496116_0018344 3300048919 Bacteria 5397
35 Ga0496116_0020245 3300048919 Bacteria 5059
36 Ga0496116_0043439 3300048919 Unclassified 3062
37 Ga0496116_0085829 3300048919 Bacteria 1933
38 Ga0496120_0155730 3300048923 Bacteria 1144
39 Ga0496121_0102095 3300048924 Bacteria 2210
40 Ga0496121_0173196 3300048924 Bacteria 1565
41 Ga0496122_0000829 3300048925 Bacteria 58836
42 Ga0496122_0001049 3300048925 Bacteria 48374
43 Ga0496122_0025286 3300048925 Bacteria 5160
44 Ga0496122_0026738 3300048925 Bacteria 4962
45 Ga0496122_0027056 3300048925 Bacteria 4917
46 Ga0496122_0040852 3300048925 Bacteria 3679
47 Ga0496122_0043056 3300048925 Unclassified 3542
48 Ga0496122_0043937 3300048925 Bacteria 3494
49 Ga0496122_0199173 3300048925 Bacteria 1173
50 Ga0496123_0004619 3300048926 Bacteria 14317
51 Ga0496123_0024464 3300048926 Bacteria 4589
52 Ga0496123_0031858 3300048926 Bacteria 3827
53 Ga0496123_0056497 3300048926 Unclassified 2564
54 Ga0496123_0072074 3300048926 Unclassified 2151
55 Ga0496124_0000726 3300048927 Bacteria 54096
56 Ga0496124_0001055 3300048927 Bacteria 43508
57 Ga0496124_0002246 3300048927 Bacteria 25686
58 Ga0496125_0000075 3300048928 Bacteria 234414
59 Ga0496125_0000739 3300048928 Bacteria 54062
60 Ga0496125_0001395 3300048928 Bacteria 35349
61 Ga0496125_0003012 3300048928 Bacteria 21074
62 Ga0496125_0004431 3300048928 Bacteria 16201
63 Ga0496125_0007692 3300048928 Bacteria 11421
64 Ga0496125_0210153 3300048928 Bacteria 1264
65 Ga0496126_0000288 3300048929 Bacteria 106694
66 Ga0496126_0000714 3300048929 Bacteria 60351
67 Ga0501312_000756 3300049528 Bacteria 2813
68 Ga0501202_023065 3300049652 Bacteria 1253
69 Ga0501217_004399 3300049661 Bacteria 2894
70 Ga0501251_008651 3300049681 Bacteria 1157
71 Ga0501245_005140 3300049708 Bacteria 1810
72 2512731535 2512564039 Bacteria 8739048
73 2550899850 2548877040 Bacteria 7507281
74 2550905632 2548877040 Bacteria 7507281
75 2550906319 2548877040 Bacteria 7507281
76 2550906324 2548877040 Bacteria 7507281
77 2571531506 2571042143 Bacteria 6986194
78 2578337955 2576861424 Bacteria 5270569
79 2587739493 2585428059 Bacteria 8696589
80 2587739757 2585428059 Bacteria 8696589
81 2587740008 2585428059 Bacteria 8696589
82 2587741443 2585428059 Bacteria 8696589
83 2587741476 2585428059 Bacteria 8696589
84 2587742211 2585428059 Bacteria 8696589
85 2595317109 2593339198 Bacteria 7267884
86 2595317134 2593339198 Bacteria 7267884
87 2595317161 2593339198 Bacteria 7267884
88 2595318921 2593339198 Bacteria 7267884
89 2643735876 2643221543 Bacteria 6628015
90 2644424092 2643221676 Bacteria 8119172
91 2644424379 2643221676 Bacteria 8119172
92 2644426255 2643221676 Bacteria 8119172
93 2644427894 2643221676 Bacteria 8119172
94 2644428298 2643221676 Bacteria 8119172
95 2728530088 2728368933 Bacteria 7044283
96 2728534309 2728368933 Bacteria 7044283
97 2793184250 2791355222 Bacteria 5898266
98 2793184854 2791355222 Bacteria 5898266
99 2793185324 2791355222 Bacteria 5898266
100 2793185504 2791355222 Bacteria 5898266
101 2802436631 2802428803 Bacteria 5806948
102 2808883909 2808606368 Bacteria 3174172
103 2819670736 2818991459 Bacteria 8736032
104 2821112234 2821111986 Bacteria 6894338
105 2821113701 2821111986 Bacteria 6894338
106 2857453479 2857453340 Bacteria 8090534
107 2857455078 2857453340 Bacteria 8090534
108 2857456035 2857453340 Bacteria 8090534
109 2857473330 2857472729 Bacteria 6568124
110 2857475410 2857472729 Bacteria 6568124
111 2864733998 2864733723 Bacteria 6770668
112 2864734026 2864733723 Bacteria 6770668
113 2865004865 2865002811 Bacteria 6333767
114 2885527074 2885526491 Bacteria 7164189
115 2888579765 2888578766 Bacteria 6743310
116 2888580268 2888578766 Bacteria 6743310
117 2888584155 2888578766 Bacteria 6743310
118 2889044675 2889042446 Bacteria 7618936
119 2889053426 2889049205 Bacteria 7524325
120 2889054014 2889049205 Bacteria 7524325
121 2904117995 2904113452 Bacteria 7796941
122 2904119364 2904113452 Bacteria 7796941
123 2904119936 2904113452 Bacteria 7796941
124 2904165599 2904162308 Bacteria 7086713
125 2904491561 2904490793 Bacteria 7046938
126 2904760861 2904755435 Bacteria 7986759
127 2919160819 2919160200 Bacteria 6929020
128 2919428737 2919425241 Bacteria 8055701
129 2931388111 2931384279 Bacteria 7299545
130 2938650036 2938649242 Bacteria 7118381
131 2938653844 2938649242 Bacteria 7118381
132 2938654961 2938649242 Bacteria 7118381
133 2939681522 2939679117 Bacteria 6921672
134 2939681552 2939679117 Bacteria 6921672
135 2945993281 2945991243 Bacteria 7008369
136 2946056036 2946053406 Bacteria 6978655
137 2968560872 2968558590 Bacteria 6956864
138 2968562538 2968558590 Bacteria 6956864
139 2971407082 2971403814 Bacteria 7370929
140 2971407096 2971403814 Bacteria 7370929
141 2971409987 2971403814 Bacteria 7370929
142 2971412000 2971410472 Bacteria 8311090
143 2971413704 2971410472 Bacteria 8311090
144 2980183749 2980182181 Bacteria 9454109
145 2980188940 2980182181 Bacteria 9454109
146 2988226385 2988225383 Bacteria 7221625
147 2988231077 2988225383 Bacteria 7221625
148 2996635876 2996632988 Bacteria 6921523
149 2996639325 2996632988 Bacteria 6921523
150 3006971036 3006969106 Bacteria 4739423
151 3006989943 3006988479 Bacteria 4767936
152 8007372285 8007371054 Bacteria 4849201
153 8046993360 8046991243 Bacteria 8497463
154 8046996082 8046991243 Bacteria 8497463
155 8054470084 8054465665 Bacteria 7323556
156 8054472154 8054465665 Bacteria 7323556
157 8054795563 8054795415 Bacteria 9785225
158 8054800804 8054795415 Bacteria 9785225
159 8054801159 8054795415 Bacteria 9785225
160 8054802593 8054795415 Bacteria 9785225
161 8056534270 8056533031 Bacteria 8964429
162 8056534295 8056533031 Bacteria 8964429
163 8056537667 8056533031 Bacteria 8964429
164 8056540483 8056533031 Bacteria 8964429
165 8057475529 8057473075 Bacteria 5892720
166 Ga0496124_0002013
167 JGI25162J39368_1008350
168 Ga0055541_1000605
169 Ga0055541_1003236
170 Ga0055541_1009498
171 Ga0055541_1011150
172 Ga0105244_10003918
173 Ga0105244_10011579
174 Ga0209566_100022
175 Ga0209566_100054
176 Ga0209566_100111
177 Ga0209566_103898
178 Ga0209437_100726
179 Ga0209675_1004801
180 Ga0207655_1040044
181 Ga0307409_100063916
182 Ga0307409_100065394
183 Ga0307416_100025431
184 Ga0395899_0009850
185 Ga0395899_0039748
186 Ga0395899_0186570
187 Ga0439449_0000507
188 Ga0439449_0059819
189 Ga0453683_0017050
190 Ga0453684_0569819
191 Ga0495637_0058296
192 Ga0495660_0039931
193 Ga0496112_0067948
194 Ga0496116_0002088
195 Ga0496116_0005247
196 Ga0496116_0009006
197 Ga0496116_0011552
198 Ga0496116_0016700
199 Ga0496116_0018344
200 Ga0496116_0020245
201 Ga0496116_0043439
202 Ga0496116_0085829
203 Ga0496120_0155730
204 Ga0496121_0102095
205 Ga0496121_0173196
206 Ga0496122_0000829
207 Ga0496122_0001049
208 Ga0496122_0025286
209 Ga0496122_0026738
210 Ga0496122_0027056
211 Ga0496122_0040852
212 Ga0496122_0043056
213 Ga0496122_0043937
214 Ga0496122_0199173
215 Ga0496123_0004619
216 Ga0496123_0024464
217 Ga0496123_0031858
218 Ga0496123_0056497
219 Ga0496123_0072074
220 Ga0496124_0000726
221 Ga0496124_0001055
222 Ga0496124_0002246
223 Ga0496125_0000075
224 Ga0496125_0000739
225 Ga0496125_0001395
226 Ga0496125_0003012
227 Ga0496125_0004431
228 Ga0496125_0007692
229 Ga0496125_0210153
230 Ga0496126_0000288
231 Ga0496126_0000714
232 Ga0501312_000756
233 Ga0501202_023065
234 Ga0501217_004399
235 Ga0501251_008651
236 Ga0501245_005140
237 2512731535
238 2550899850
239 2550905632
240 2550906319
241 2550906324
242 2571531506
243 2578337955
244 2587739493
245 2587739757
246 2587740008
247 2587741443
248 2587741476
249 2587742211
250 2595317109
251 2595317134
252 2595317161
253 2595318921
254 2643735876
255 2644424092
256 2644424379
257 2644426255
258 2644427894
259 2644428298
260 2728530088
261 2728534309
262 2793184250
263 2793184854
264 2793185324
265 2793185504
266 2802436631
267 2808883909
268 2819670736
269 2821112234
270 2821113701
271 2857453479
272 2857455078
273 2857456035
274 2857473330
275 2857475410
276 2864733998
277 2864734026
278 2865004865
279 2885527074
280 2888579765
281 2888580268
282 2888584155
283 2889044675
284 2889053426
285 2889054014
286 2904117995
287 2904119364
288 2904119936
289 2904165599
290 2904491561
291 2904760861
292 2919160819
293 2919428737
294 2931388111
295 2938650036
296 2938653844
297 2938654961
298 2939681522
299 2939681552
300 2945993281
301 2946056036
302 2968560872
303 2968562538
304 2971407082
305 2971407096
306 2971409987
307 2971412000
308 2971413704
309 2980183749
310 2980188940
311 2988226385
312 2988231077
313 2996635876
314 2996639325
315 3006971036
316 3006989943
317 8007372285
318 8046993360
319 8046996082
320 8054470084
321 8054472154
322 8054795563
323 8054800804
324 8054801159
325 8054802593
326 8056534270
327 8056534295
328 8056537667
329 8056540483
330 8057475529

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

139

352

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tqu-assembly1.cif.gz_M crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.9146 25 322
4tqu-assembly1.cif.gz_M crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.9085 25 322
4tqv-assembly4.cif.gz_M crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.9079 25 322
4xtc-assembly1.cif.gz_M crystal structure of bacterial alginate abc transporter in complex with alginate pentasaccharide-bound periplasmic protein 0.9052 25 323
4tqv-assembly4.cif.gz_M crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.9019 25 322
ID Description Score Start End Superfamily
4tquM01 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9197 76 322 1.10.3720.10
4tquM01 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9126 76 322 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8901 76 320 1.10.3720.10
af_P10905_52_292_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8877 76 320 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8872 76 320 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A416ESL2-F1-model_v4 Sugar ABC transporter permease 0.9446 39 328 GO:0005886
GO:0055085
AF-A0A2R5F5M2-F1-model_v4 Sugar ABC transporter permease 0.9445 62 328 GO:0005886
GO:0055085
AF-A0A8A5ZJQ4-F1-model_v4 deleted 0.9441 58 328
AF-A0A1D8JIS8-F1-model_v4 Protein lplB 0.9423 23 320 GO:0005886
GO:0055085
AF-A0A328UEB0-F1-model_v4 Sugar ABC transporter permease 0.9416 57 328 GO:0005886
GO:0055085

Map