F250914

General Info

Members Datasets Scaffolds Average Seq Length
167 107 149 189

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0000155|Ga0395900_0000155_84579_85163
Length 194
Sequence MLQAVNAVKNFGHINRNITMNTQLTWGQFKEILLQNPSLDLQFQYSGNNKVAPSYHITEIKQAPITSVDCGGKMNSWTEIVVQLLEPSVETQLRPMKVRKALSIIEVVEKALPLNPVGIVKIEFGNDTFETRQMYLNDFVIDNEEMTIDLRPDTVQCKAIERGGSCGTPAEKPKLNLKDIASSASCCIPGGGCC

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
4 2738541283 Pedobacter sp. OK701 Isolate Unclassified
5 2738541302 Pedobacter sp. CF074 Isolate Unclassified
6 2738543023 Pedobacter sp. OK628 Isolate Unclassified
7 2739367651 Pedobacter sp. OK291 Isolate Unclassified
8 2818991437 Pedobacter terrae 518 Isolate Unclassified
9 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
10 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
11 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
12 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
13 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
14 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
15 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
16 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
17 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
18 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
19 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
20 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
21 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
22 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
23 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
24 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
25 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
26 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
51 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
53 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
54 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
55 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
63 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
64 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
65 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
66 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
67 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
68 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
69 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
76 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
77 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
78 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
79 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
80 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
81 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
82 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
83 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
84 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
85 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
86 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
87 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
88 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
89 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
90 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
91 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
92 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
93 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
94 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
95 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
96 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
97 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
98 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
99 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
100 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
101 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
102 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
103 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
104 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
105 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
106 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
107 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.22
Metatranscriptomes 0
Isolates 10.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.57
Nodule 0
Rhizoplane 0
Rhizosphere 72.46
Stem 0
Stem Tuber 0
Unclassified 14.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1994768 2162886007 Bacteria 1155
2 JGI24740J21852_10093251 3300001979 Bacteria 775
3 JGI25162J39368_1003960 3300002737 Bacteria 3777
4 JGI25152J39213_1000147 3300002773 Bacteria 48391
5 JGI25150J39212_1000008 3300002774 Bacteria 253098
6 JGI25151J46595_10000014 3300003187 Bacteria 253098
7 JGI25153J46596_10000020 3300003215 Bacteria 252978
8 rootH1_10011984 3300003316 Bacteria 6423
9 rootH1_10061908 3300003316 Bacteria 8102
10 rootL2_10175893 3300003322 Bacteria 4945
11 rootL2_10265490 3300003322 Bacteria 2484
12 rootH1_10397766 3300003323 Unclassified 1115
13 Ga0065714_10064476 3300005288 Bacteria 57050
14 Ga0065714_10092798 3300005288 Bacteria 1821
15 Ga0065714_10108286 3300005288 Bacteria 1517
16 Ga0065714_10142318 3300005288 Bacteria 1162
17 Ga0065704_10095260 3300005289 Bacteria 2497
18 Ga0065704_10179229 3300005289 Bacteria 1246
19 Ga0068853_100262534 3300005539 Bacteria 1588
20 Ga0068857_100293679 3300005577 Bacteria 1497
21 Ga0075366_10000660 3300006195 Bacteria 16235
22 Ga0105240_10054898 3300009093 Bacteria 4990
23 Ga0105240_11000731 3300009093 Bacteria 894
24 Ga0105240_11543654 3300009093 Unclassified 696
25 Ga0105241_10047458 3300009174 Bacteria 3266
26 Ga0105241_10047598 3300009174 Bacteria 3261
27 Ga0105237_10019933 3300009545 Bacteria 6923
28 Ga0105237_10111475 3300009545 Bacteria 2728
29 Ga0105237_10159423 3300009545 Bacteria 2254
30 Ga0105237_10193851 3300009545 Bacteria 2031
31 Ga0105239_10000036 3300010375 Bacteria 212090
32 Ga0105239_10003569 3300010375 Bacteria 19023
33 Ga0105239_10028969 3300010375 Bacteria 6086
34 Ga0105239_10035617 3300010375 Bacteria 5465
35 Ga0157373_10000360 3300013100 Bacteria 36657
36 Ga0157371_10000009 3300013102 Bacteria 392895
37 Ga0157371_10002456 3300013102 Bacteria 17666
38 Ga0157370_10007964 3300013104 Bacteria 11480
39 Ga0157370_10047268 3300013104 Bacteria 4126
40 Ga0157369_10000006 3300013105 Bacteria 412230
41 Ga0157374_10256963 3300013296 Bacteria 1720
42 Ga0157378_10006153 3300013297 Bacteria 10506
43 Ga0163162_10000459 3300013306 Bacteria 37749
44 Ga0163162_10000663 3300013306 Bacteria 31885
45 Ga0157372_10235372 3300013307 Bacteria 2124
46 Ga0157375_10019874 3300013308 Bacteria 6122
47 Ga0182008_10001648 3300014497 Bacteria 14754
48 Ga0182008_10223210 3300014497 Bacteria 965
49 Ga0182006_1000904 3300015261 Bacteria 19844
50 Ga0182006_1001184 3300015261 Bacteria 16349
51 Ga0182007_10000001 3300015262 Bacteria 1127301
52 Ga0183373_1006 3300015682 Bacteria 328276
53 Ga0163161_10001439 3300017792 Bacteria 17576
54 Ga0163161_10001878 3300017792 Bacteria 15335
55 Ga0163161_10004368 3300017792 Bacteria 9855
56 Ga0163161_10005047 3300017792 Bacteria 9183
57 Ga0209437_100030 3300025233 Bacteria 532466
58 Ga0209258_114603 3300025242 Bacteria 911
59 Ga0207425_1000007 3300025245 Bacteria 777411
60 Ga0209026_1001326 3300025250 Bacteria 11129
61 Ga0209129_1000006 3300025258 Bacteria 777761
62 Ga0209025_1000089 3300025294 Bacteria 254130
63 Ga0209758_1000016 3300025297 Bacteria 778557
64 Ga0207654_10559747 3300025911 Bacteria 813
65 Ga0207695_10270311 3300025913 Bacteria 1595
66 Ga0207671_10003362 3300025914 Bacteria 16046
67 Ga0207671_10006318 3300025914 Bacteria 10576
68 Ga0207671_10012780 3300025914 Bacteria 6731
69 Ga0207671_10285121 3300025914 Bacteria 1303
70 Ga0207694_10384734 3300025924 Bacteria 1165
71 Ga0207639_10277502 3300026041 Bacteria 1473
72 Ga0307515_10000318 3300028794 Bacteria 118891
73 Ga0307515_10017059 3300028794 Bacteria 13257
74 Ga0316177_1201147 3300030731 Bacteria 11810
75 Ga0316176_1043240 3300030732 Bacteria 38084
76 Ga0316183_1007655 3300030742 Bacteria 9211
77 Ga0316181_1251180 3300030744 Bacteria 1924
78 Ga0307405_10000010 3300031731 Bacteria 250978
79 Ga0307407_10000001 3300031903 Bacteria 570048
80 Ga0307407_10000296 3300031903 Bacteria 14705
81 Ga0307412_10000063 3300031911 Bacteria 125959
82 Ga0307412_10025342 3300031911 Bacteria 3673
83 Ga0307409_100091885 3300031995 Bacteria 2489
84 Ga0307409_100169456 3300031995 Bacteria 1920
85 Ga0307416_100000026 3300032002 Bacteria 172622
86 Ga0307416_100001050 3300032002 Bacteria 14706
87 Ga0307414_10000690 3300032004 Bacteria 17319
88 Ga0307414_10012470 3300032004 Bacteria 5026
89 Ga0307414_10447571 3300032004 Bacteria 1132
90 Ga0307414_10473098 3300032004 Bacteria 1104
91 Ga0307414_10647241 3300032004 Unclassified 952
92 Ga0307507_10000159 3300033179 Bacteria 120125
93 Ga0395900_0000155 3300037418 Bacteria 113606
94 Ga0495650_0000050 3300046471 Bacteria 318894
95 Ga0495585_0000477 3300046492 Bacteria 38276
96 Ga0495606_0000036 3300046507 Bacteria 234596
97 Ga0495606_0019305 3300046507 Bacteria 5077
98 Ga0495606_0058994 3300046507 Bacteria 2464
99 Ga0495610_0000028 3300046512 Bacteria 272572
100 Ga0495610_0000167 3300046512 Bacteria 73458
101 Ga0495610_0000791 3300046512 Bacteria 29641
102 Ga0495610_0001572 3300046512 Bacteria 20100
103 Ga0495610_0119051 3300046512 Bacteria 1160
104 Ga0495618_0248663 3300046514 Bacteria 1116
105 Ga0495628_0329755 3300046516 Bacteria 1125
106 Ga0495632_0041937 3300046519 Bacteria 2297
107 Ga0495648_0007084 3300046524 Bacteria 9028
108 Ga0495648_0062608 3300046524 Bacteria 2202
109 Ga0495648_0094092 3300046524 Bacteria 1670
110 Ga0495652_0330310 3300046529 Bacteria 1099
111 Ga0495609_0005232 3300046538 Bacteria 6903
112 Ga0495609_0008801 3300046538 Bacteria 4913
113 Ga0495622_0037644 3300046557 Bacteria 2253
114 Ga0495622_0138466 3300046557 Bacteria 1106
115 Ga0495633_0000295 3300046558 Bacteria 56870
116 Ga0495633_0002805 3300046558 Bacteria 12052
117 Ga0495633_0038596 3300046558 Bacteria 2280
118 Ga0495668_0000121 3300046616 Bacteria 116234
119 Ga0495668_0000489 3300046616 Bacteria 49613
120 Ga0495668_0094882 3300046616 Bacteria 1633
121 Ga0495625_0000105 3300046660 Bacteria 126078
122 Ga0495625_0001033 3300046660 Bacteria 36654
123 Ga0495625_0003507 3300046660 Bacteria 15548
124 Ga0495625_0055219 3300046660 Bacteria 2833
125 Ga0495625_0113203 3300046660 Bacteria 1853
126 Ga0495661_0065499 3300046665 Bacteria 2141
127 Ga0495658_0028365 3300046683 Bacteria 3021
128 Ga0495649_0000011 3300046694 Bacteria 416695
129 Ga0495660_0110152 3300046810 Bacteria 1406
130 Ga0495683_0074537 3300047323 Bacteria 1663
131 Ga0495687_033512 3300047443 Bacteria 2328
132 Ga0495687_047678 3300047443 Bacteria 1842
133 Ga0495686_0000111 3300047472 Bacteria 168708
134 Ga0495686_0237466 3300047472 Bacteria 1029
135 Ga0496116_0000501 3300048919 Bacteria 53592
136 Ga0496117_0001265 3300048920 Bacteria 37550
137 Ga0496122_0000391 3300048925 Bacteria 93479
138 Ga0496122_0005454 3300048925 Bacteria 15138
139 Ga0496123_0012360 3300048926 Bacteria 7288
140 Ga0496123_0080315 3300048926 Bacteria 1988
141 nmdc:mga0k408_2016_c1 3300050493 Bacteria 10890
142 nmdc:mga0k408_710_c1 3300050493 Bacteria 18223
143 Ga0500556_0129156 3300053104 Bacteria 990
144 Ga0500608_049037 3300053122 Bacteria 2029
145 Ga0500618_000012 3300053125 Bacteria 185382
146 Ga0500561_0083400 3300053137 Bacteria 935
147 Ga0500616_0004907 3300053153 Bacteria 9299
148 Ga0500622_0180567 3300053156 Bacteria 975
149 Ga0500627_0007032 3300053158 Bacteria 3884

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10397766 rootH1_103977662 175
2 3300037418 Ga0395900_0000155 Ga0395900_0000155_84579_85163 177
3 3300013297 Ga0157378_10006153 Ga0157378_100061538 178
4 3300013308 Ga0157375_10019874 Ga0157375_100198746 178
5 3300005288 Ga0065714_10108286 Ga0065714_101082863 182
6 3300009545 Ga0105237_10193851 Ga0105237_101938512 182
7 3300025914 Ga0207671_10006318 Ga0207671_100063186 182
8 3300046616 Ga0495668_0000489 Ga0495668_0000489_24184_24735 182
9 3300053104 Ga0500556_0129156 Ga0500556_0129156_26_577 182
10 3300053153 Ga0500616_0004907 Ga0500616_0004907_3346_3897 182
11 iso_pu_bacteria 2842903701 2842904354 183
12 iso_pu_bacteria 2884933994 2884935297 183
13 iso_pu_bacteria 2919437846 2919442954 183
14 3300013104 Ga0157370_10047268 Ga0157370_100472684 184
15 iso_pu_bacteria 2585427687 2586208378 184
16 iso_pu_bacteria 2721755487 2722728851 184
17 iso_pu_bacteria 2738541302 2738855966 184
18 iso_pu_bacteria 2738543023 2739303469 184
19 iso_pu_bacteria 2739367651 2739588408 184
20 iso_pu_bacteria 2818991437 2819548284 184
21 iso_pu_bacteria 2842722452 2842723553 184
22 iso_pu_bacteria 2842909656 2842910060 184
23 iso_pu_bacteria 2852623160 2852624246 184
24 iso_pu_bacteria 2852623160 2852626161 184
25 iso_pu_bacteria 2954016120 2954017280 184
26 iso_pu_bacteria 2977232053 2977232269 184
27 3300001979 JGI24740J21852_10093251 JGI24740J21852_100932512 185
28 3300005288 Ga0065714_10092798 Ga0065714_100927982 185
29 3300046514 Ga0495618_0248663 Ga0495618_0248663_545_1102 185
30 3300053122 Ga0500608_049037 Ga0500608_049037_521_1078 185
31 iso_pu_bacteria 2738541283 2738758103 185
32 iso_pu_bacteria 2852627209 2852630424 185
33 3300003322 rootL2_10265490 rootL2_102654902 186
34 3300013100 Ga0157373_10000360 Ga0157373_1000036020 186
35 3300014497 Ga0182008_10223210 Ga0182008_102232102 186
36 3300028794 Ga0307515_10000318 Ga0307515_1000031897 186
37 3300046507 Ga0495606_0058994 Ga0495606_0058994_778_1338 186
38 3300046538 Ga0495609_0008801 Ga0495609_0008801_2851_3411 186
39 3300047472 Ga0495686_0000111 Ga0495686_0000111_9739_10299 186
40 iso_pu_bacteria 2977232053 2977234809 186
41 3300002737 JGI25162J39368_1003960 JGI25162J39368_10039602 187
42 3300002773 JGI25152J39213_1000147 JGI25152J39213_10001474 187
43 3300002774 JGI25150J39212_1000008 JGI25150J39212_1000008149 187
44 3300003187 JGI25151J46595_10000014 JGI25151J46595_10000014149 187
45 3300003215 JGI25153J46596_10000020 JGI25153J46596_10000020149 187
46 3300003316 rootH1_10011984 rootH1_100119842 187
47 3300003316 rootH1_10061908 rootH1_100619088 187
48 3300003322 rootL2_10175893 rootL2_101758936 187
49 3300005289 Ga0065704_10179229 Ga0065704_101792292 187
50 3300005539 Ga0068853_100262534 Ga0068853_1002625343 187
51 3300005577 Ga0068857_100293679 Ga0068857_1002936792 187
52 3300009093 Ga0105240_10054898 Ga0105240_100548986 187
53 3300009093 Ga0105240_11000731 Ga0105240_110007311 187
54 3300009093 Ga0105240_11543654 Ga0105240_115436541 187
55 3300009174 Ga0105241_10047458 Ga0105241_100474585 187
56 3300009174 Ga0105241_10047598 Ga0105241_100475984 187
57 3300009545 Ga0105237_10019933 Ga0105237_100199337 187
58 3300009545 Ga0105237_10111475 Ga0105237_101114754 187
59 3300010375 Ga0105239_10000036 Ga0105239_100000367 187
60 3300010375 Ga0105239_10003569 Ga0105239_100035698 187
61 3300010375 Ga0105239_10028969 Ga0105239_100289698 187
62 3300010375 Ga0105239_10035617 Ga0105239_100356172 187
63 3300013306 Ga0163162_10000459 Ga0163162_1000045937 187
64 3300017792 Ga0163161_10004368 Ga0163161_1000436813 187
65 3300025233 Ga0209437_100030 Ga0209437_1000304 187
66 3300025242 Ga0209258_114603 Ga0209258_1146032 187
67 3300025245 Ga0207425_1000007 Ga0207425_100000731 187
68 3300025258 Ga0209129_1000006 Ga0209129_100000631 187
69 3300025294 Ga0209025_1000089 Ga0209025_1000089141 187
70 3300025297 Ga0209758_1000016 Ga0209758_100001631 187
71 3300025913 Ga0207695_10270311 Ga0207695_102703113 187
72 3300025914 Ga0207671_10003362 Ga0207671_1000336210 187
73 3300025914 Ga0207671_10285121 Ga0207671_102851213 187
74 3300025924 Ga0207694_10384734 Ga0207694_103847342 187
75 3300026041 Ga0207639_10277502 Ga0207639_102775022 187
76 3300030731 Ga0316177_1201147 Ga0316177_12011472 187
77 3300030732 Ga0316176_1043240 Ga0316176_104324040 187
78 3300030742 Ga0316183_1007655 Ga0316183_10076559 187
79 3300032004 Ga0307414_10647241 Ga0307414_106472412 187
80 3300046471 Ga0495650_0000050 Ga0495650_0000050_251230_251793 187
81 3300046507 Ga0495606_0000036 Ga0495606_0000036_1179_1742 187
82 3300046507 Ga0495606_0019305 Ga0495606_0019305_1852_2415 187
83 3300046512 Ga0495610_0001572 Ga0495610_0001572_18246_18809 187
84 3300046512 Ga0495610_0119051 Ga0495610_0119051_224_790 187
85 3300046519 Ga0495632_0041937 Ga0495632_0041937_1443_2006 187
86 3300046524 Ga0495648_0062608 Ga0495648_0062608_487_1050 187
87 3300046529 Ga0495652_0330310 Ga0495652_0330310_229_795 187
88 3300046538 Ga0495609_0005232 Ga0495609_0005232_4561_5124 187
89 3300046557 Ga0495622_0138466 Ga0495622_0138466_105_668 187
90 3300046558 Ga0495633_0002805 Ga0495633_0002805_6453_7016 187
91 3300046616 Ga0495668_0094882 Ga0495668_0094882_549_1178 187
92 3300046660 Ga0495625_0000105 Ga0495625_0000105_15474_16037 187
93 3300046660 Ga0495625_0055219 Ga0495625_0055219_237_803 187
94 3300046660 Ga0495625_0113203 Ga0495625_0113203_829_1392 187
95 3300046665 Ga0495661_0065499 Ga0495661_0065499_366_929 187
96 3300046694 Ga0495649_0000011 Ga0495649_0000011_108904_109467 187
97 3300046810 Ga0495660_0110152 Ga0495660_0110152_542_1105 187
98 3300047443 Ga0495687_033512 Ga0495687_033512_30_593 187
99 3300047443 Ga0495687_047678 Ga0495687_047678_1042_1605 187
100 3300047472 Ga0495686_0237466 Ga0495686_0237466_275_838 187
101 3300050493 nmdc:mga0k408_2016_c1 nmdc:mga0k408_2016_c1_7714_8280 187
102 3300053156 Ga0500622_0180567 Ga0500622_0180567_281_844 187
103 3300005288 Ga0065714_10064476 Ga0065714_1006447631 188
104 3300005288 Ga0065714_10142318 Ga0065714_101423182 188
105 3300006195 Ga0075366_10000660 Ga0075366_100006608 188
106 3300009545 Ga0105237_10159423 Ga0105237_101594232 188
107 3300013102 Ga0157371_10000009 Ga0157371_10000009180 188
108 3300013105 Ga0157369_10000006 Ga0157369_10000006148 188
109 3300013296 Ga0157374_10256963 Ga0157374_102569631 188
110 3300013306 Ga0163162_10000663 Ga0163162_100006634 188
111 3300013307 Ga0157372_10235372 Ga0157372_102353722 188
112 3300015261 Ga0182006_1001184 Ga0182006_100118417 188
113 3300015262 Ga0182007_10000001 Ga0182007_1000000190 188
114 3300015682 Ga0183373_1006 Ga0183373_100696 188
115 3300017792 Ga0163161_10001439 Ga0163161_100014394 188
116 3300017792 Ga0163161_10001878 Ga0163161_100018784 188
117 3300025250 Ga0209026_1001326 Ga0209026_100132610 188
118 3300025911 Ga0207654_10559747 Ga0207654_105597471 188
119 3300028794 Ga0307515_10017059 Ga0307515_100170598 188
120 3300031731 Ga0307405_10000010 Ga0307405_10000010234 188
121 3300031903 Ga0307407_10000001 Ga0307407_10000001505 188
122 3300031903 Ga0307407_10000296 Ga0307407_1000029615 188
123 3300031911 Ga0307412_10025342 Ga0307412_100253422 188
124 3300031995 Ga0307409_100091885 Ga0307409_1000918852 188
125 3300031995 Ga0307409_100169456 Ga0307409_1001694564 188
126 3300032002 Ga0307416_100000026 Ga0307416_10000002648 188
127 3300032002 Ga0307416_100001050 Ga0307416_1000010502 188
128 3300032004 Ga0307414_10000690 Ga0307414_1000069013 188
129 3300032004 Ga0307414_10012470 Ga0307414_100124706 188
130 3300032004 Ga0307414_10447571 Ga0307414_104475712 188
131 3300032004 Ga0307414_10473098 Ga0307414_104730982 188
132 3300033179 Ga0307507_10000159 Ga0307507_10000159102 188
133 3300046492 Ga0495585_0000477 Ga0495585_0000477_25896_26525 188
134 3300046512 Ga0495610_0000028 Ga0495610_0000028_57874_58440 188
135 3300046512 Ga0495610_0000167 Ga0495610_0000167_71927_72493 188
136 3300046512 Ga0495610_0000791 Ga0495610_0000791_788_1354 188
137 3300046516 Ga0495628_0329755 Ga0495628_0329755_42_611 188
138 3300046524 Ga0495648_0007084 Ga0495648_0007084_1628_2257 188
139 3300046524 Ga0495648_0094092 Ga0495648_0094092_171_797 188
140 3300046557 Ga0495622_0037644 Ga0495622_0037644_12_698 188
141 3300046558 Ga0495633_0000295 Ga0495633_0000295_8263_8829 188
142 3300046558 Ga0495633_0038596 Ga0495633_0038596_1060_1626 188
143 3300046616 Ga0495668_0000121 Ga0495668_0000121_46295_46921 188
144 3300046660 Ga0495625_0001033 Ga0495625_0001033_5675_6301 188
145 3300046660 Ga0495625_0003507 Ga0495625_0003507_11766_12395 188
146 3300046683 Ga0495658_0028365 Ga0495658_0028365_35_721 188
147 3300047323 Ga0495683_0074537 Ga0495683_0074537_763_1329 188
148 3300048919 Ga0496116_0000501 Ga0496116_0000501_10750_11319 188
149 3300048920 Ga0496117_0001265 Ga0496117_0001265_7916_8485 188
150 3300048925 Ga0496122_0005454 Ga0496122_0005454_13987_14556 188
151 3300048926 Ga0496123_0080315 Ga0496123_0080315_764_1333 188
152 3300050493 nmdc:mga0k408_710_c1 nmdc:mga0k408_710_c1_9761_10387 188
153 3300053125 Ga0500618_000012 Ga0500618_000012_150260_150829 188
154 3300053137 Ga0500561_0083400 Ga0500561_0083400_165_851 188
155 3300053158 Ga0500627_0007032 Ga0500627_0007032_1358_1927 188
156 3300013104 Ga0157370_10007964 Ga0157370_100079645 189
157 3300014497 Ga0182008_10001648 Ga0182008_1000164810 189
158 3300015261 Ga0182006_1000904 Ga0182006_100090413 189
159 3300017792 Ga0163161_10005047 Ga0163161_100050475 189
160 3300025914 Ga0207671_10012780 Ga0207671_100127804 189
161 3300031911 Ga0307412_10000063 Ga0307412_1000006345 189
162 3300048925 Ga0496122_0000391 Ga0496122_0000391_74548_75126 189
163 3300048926 Ga0496123_0012360 Ga0496123_0012360_4536_5114 189
164 2162886007 SwRhRL2b_contig_1994768 SwRhRL2b_0223.00003400 192
165 3300005289 Ga0065704_10095260 Ga0065704_100952602 192
166 3300013102 Ga0157371_10002456 Ga0157371_1000245620 192
167 3300030744 Ga0316181_1251180 Ga0316181_12511803 192

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20001

DUF6428

Family of unknown function (DUF6428)

47

194

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pkh-assembly1.cif.gz_A-2 zebrafish n-acetylglucosamine-1-phosphodiester alpha-n-acetylglucosaminidase (nagpa) catalytic domain auto-inhibited by pro-peptide 0.7932 37 63
6pki-assembly2.cif.gz_D zebrafish n-acetylglucosamine-1-phosphodiester alpha-n-acetylglucosaminidase (nagpa) catalytic domain (c56s c230s) in complex with n-acetyl-alpha-d-glucosamine (alpha-glcnac) and mannose 6-phosphate (m6p) 0.777 37 63
6pki-assembly2.cif.gz_C zebrafish n-acetylglucosamine-1-phosphodiester alpha-n-acetylglucosaminidase (nagpa) catalytic domain (c56s c230s) in complex with n-acetyl-alpha-d-glucosamine (alpha-glcnac) and mannose 6-phosphate (m6p) 0.7723 37 63
6pki-assembly1.cif.gz_A zebrafish n-acetylglucosamine-1-phosphodiester alpha-n-acetylglucosaminidase (nagpa) catalytic domain (c56s c230s) in complex with n-acetyl-alpha-d-glucosamine (alpha-glcnac) and mannose 6-phosphate (m6p) 0.7568 37 63
3ul5-assembly1.cif.gz_A saccharum officinarum canecystatin-1 in space group c2221 0.73 42 63
ID Description Score Start End Superfamily
af_Q9P791_1_199_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7349 43 65 3.90.79.10
af_P56475_71_278_2.70.170.10 Mainly Beta;Distorted Sandwich;Acetylcholine Binding Protein; Chain: A,;Neurotransmitter-gated ion-channel ligand-binding domain 0.7081 39 59 2.70.170.10
af_Q54SQ4_460_577_3.90.132.10 Alpha Beta;Alpha-Beta Complex;Leishmanolysin; domain 2;Leishmanolysin , domain 2 0.6995 42 63 3.90.132.10
af_Q4DL65_1_217_2.115.10.20 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.6804 43 63 2.115.10.20
af_F8W2K2_23_482_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6541 44 65 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A7Y5J3S5-F1-model_v4 Uncharacterized protein 0.9276 7 133
AF-A0A2V5LK54-F1-model_v4 Uncharacterized protein 0.9148 7 126
AF-A0A7Y1YHV1-F1-model_v4 Uncharacterized protein 0.9031 7 105
AF-A0A2V5LK54-F1-model_v4 Uncharacterized protein 0.9009 7 126
AF-A0A529XH53-F1-model_v4 Uncharacterized protein 0.8834 5 121

Feature Viewer

pLDDT pTM Quality
76.02 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map