F250052

General Info

Members Datasets Scaffolds Average Seq Length
167 124 334 155

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100102094|Ga0070707_1001020945
Length 168
Sequence LTQIVAKRSARVSRPAPPAQTPAPITEEAATAVRYIESSALVAALLERDAAALKSVRTKGRLVTSALTIAEAARAILRARAAARLTADEERAAVRALRRFERRSYLVAVTDAVLARVRRPFPVEPIRTLDAVHLATAELLGEPPQLVTVVTRDDRVRNNARALGYAVE

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
68 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
69 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
70 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
75 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
76 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
77 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
78 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
79 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
80 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
81 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
82 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
83 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
84 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
85 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
86 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
98 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
99 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
100 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
101 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
102 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
103 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
104 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
105 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
106 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
107 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
108 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
109 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
110 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
111 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
113 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
114 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
117 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
118 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
119 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
120 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
121 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
122 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
123 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
124 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.8
Nodule 0
Rhizoplane 3.59
Rhizosphere 94.61
Stem 0
Stem Tuber 0
Unclassified 23.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100102094 3300005468 Bacteria 2779
2 Ga0058861_11241095 3300004800 Bacteria 612
3 Ga0065715_10314120 3300005293 Bacteria 1014
4 Ga0070683_100000062 3300005329 Bacteria 80629
5 Ga0070683_100531089 3300005329 Bacteria 1124
6 Ga0070670_100050140 3300005331 Bacteria 3588
7 Ga0070670_100111361 3300005331 Bacteria 2359
8 Ga0070660_100163601 3300005339 Unclassified 1794
9 Ga0070687_100577357 3300005343 Bacteria 769
10 Ga0070675_100413058 3300005354 Bacteria 1206
11 Ga0070671_100153173 3300005355 Bacteria 1947
12 Ga0070671_100927918 3300005355 Unclassified 761
13 Ga0070688_100137254 3300005365 Bacteria 1657
14 Ga0070667_100977494 3300005367 Unclassified 789
15 Ga0070700_100852537 3300005441 Unclassified 738
16 Ga0070663_100019690 3300005455 Bacteria 4455
17 Ga0070678_100215860 3300005456 Bacteria 1592
18 Ga0070681_10385424 3300005458 Bacteria 1312
19 Ga0068867_100146655 3300005459 Bacteria 1850
20 Ga0068867_102046731 3300005459 Bacteria 542
21 Ga0070679_100840226 3300005530 Unclassified 861
22 Ga0070679_100906688 3300005530 Unclassified 825
23 Ga0070684_100000184 3300005535 Bacteria 43259
24 Ga0068853_101918374 3300005539 Bacteria 574
25 Ga0070665_100516583 3300005548 Unclassified 1206
26 Ga0068859_101383586 3300005617 Bacteria 776
27 Ga0068864_101219070 3300005618 Unclassified 751
28 Ga0068870_10808942 3300005840 Unclassified 655
29 Ga0068863_100007908 3300005841 Bacteria 10397
30 Ga0068863_101921837 3300005841 Bacteria 602
31 Ga0068858_100723999 3300005842 Bacteria 969
32 Ga0068860_100536850 3300005843 Unclassified 1171
33 Ga0081455_10601197 3300005937 Unclassified 717
34 Ga0075432_10105960 3300006058 Unclassified 1043
35 Ga0097621_100006226 3300006237 Bacteria 8462
36 Ga0068871_100002064 3300006358 Bacteria 13615
37 Ga0075431_100308760 3300006847 Bacteria 1597
38 Ga0075431_100575710 3300006847 Bacteria 1112
39 Ga0075433_10000686 3300006852 Bacteria 23056
40 Ga0075434_100004777 3300006871 Bacteria 12269
41 Ga0075434_100430811 3300006871 Bacteria 1340
42 Ga0075434_101130723 3300006871 Bacteria 796
43 Ga0068865_100002557 3300006881 Bacteria 10791
44 Ga0075436_100019877 3300006914 Bacteria 4606
45 Ga0097620_101383905 3300006931 Bacteria 776
46 Ga0075435_100044115 3300007076 Bacteria 3571
47 Ga0075435_100143071 3300007076 Unclassified 2007
48 Ga0099794_10229775 3300007265 Bacteria 954
49 Ga0111539_10310801 3300009094 Bacteria 1834
50 Ga0111539_10362024 3300009094 Bacteria 1688
51 Ga0105245_10688182 3300009098 Bacteria 1055
52 Ga0114129_10676056 3300009147 Bacteria 1330
53 Ga0105243_10360075 3300009148 Bacteria 1339
54 Ga0105242_10012011 3300009176 Bacteria 6667
55 Ga0105248_10492665 3300009177 Bacteria 1381
56 Ga0105248_10663340 3300009177 Bacteria 1177
57 Ga0105248_11431444 3300009177 Bacteria 782
58 Ga0105239_10149573 3300010375 Bacteria 2606
59 Ga0157372_10784858 3300013307 Bacteria 1107
60 Ga0163163_10054002 3300014325 Bacteria 3968
61 Ga0163163_10260189 3300014325 Unclassified 1786
62 Ga0163163_10496541 3300014325 Bacteria 1282
63 Ga0157379_10045371 3300014968 Bacteria 3922
64 Ga0157376_10021067 3300014969 Bacteria 5058
65 Ga0207657_10092254 3300025919 Bacteria 2524
66 Ga0207686_10069918 3300025934 Bacteria 2253
67 Ga0207709_10891238 3300025935 Bacteria 723
68 Ga0207670_10659486 3300025936 Bacteria 863
69 Ga0207704_10001718 3300025938 Bacteria 9804
70 Ga0207711_10353203 3300025941 Bacteria 1361
71 Ga0207661_10003272 3300025944 Bacteria 11242
72 Ga0207703_10617504 3300026035 Bacteria 1026
73 Ga0207639_11741855 3300026041 Bacteria 583
74 Ga0207708_10899398 3300026075 Unclassified 766
75 Ga0207641_10001613 3300026088 Bacteria 21999
76 Ga0207648_10081810 3300026089 Bacteria 2816
77 Ga0207676_10007096 3300026095 Bacteria 7941
78 Ga0207675_100693640 3300026118 Bacteria 1027
79 Ga0207683_10809049 3300026121 Unclassified 870
80 Ga0268266_11822725 3300028379 Unclassified 583
81 Ga0307416_100474205 3300032002 Bacteria 1310
82 Ga0373957_0529078 3300035120 Unclassified 515
83 Ga0373955_0233747 3300035172 Bacteria 1100
84 Ga0373935_0310565 3300035692 Bacteria 1116
85 Ga0373925_0667419 3300037068 Bacteria 857
86 Ga0395898_0959665 3300037466 Bacteria 792
87 Ga0450896_027775 3300042133 Bacteria 848
88 Ga0466967_0572445 3300045976 Unclassified 1113
89 Ga0495629_0401629 3300046459 Bacteria 931
90 Ga0495628_0336236 3300046516 Bacteria 1112
91 Ga0495599_0110666 3300046678 Unclassified 1711
92 Ga0495599_0243799 3300046678 Bacteria 1095
93 Ga0495647_0180242 3300046681 Bacteria 919
94 Ga0495674_0105613 3300047319 Bacteria 2393
95 Ga0495680_0552052 3300047322 Bacteria 776
96 Ga0496104_1083558 3300048907 Bacteria 705
97 Ga0496108_0441565 3300048911 Unclassified 1137
98 Ga0496109_0531994 3300048912 Bacteria 1109
99 Ga0496112_0854101 3300048915 Unclassified 833
100 Ga0496113_0505150 3300048916 Bacteria 971
101 Ga0496114_0286209 3300048917 Unclassified 1454
102 Ga0501031_0065084 3300049568 Bacteria 2375
103 Ga0501032_0008775 3300049569 Bacteria 7363
104 Ga0501032_0017869 3300049569 Bacteria 4975
105 Ga0501034_0051661 3300049571 Bacteria 4144
106 Ga0501034_0111638 3300049571 Bacteria 2724
107 Ga0501036_0031938 3300049572 Bacteria 4448
108 Ga0501036_0093294 3300049572 Bacteria 2543
109 Ga0501037_0044452 3300049573 Bacteria 3262
110 Ga0501037_0446662 3300049573 Unclassified 882
111 Ga0501038_0006504 3300049574 Bacteria 10814
112 Ga0501038_0025281 3300049574 Bacteria 5295
113 Ga0501039_0026015 3300049575 Bacteria 4498
114 Ga0501039_0104690 3300049575 Bacteria 2209
115 Ga0501043_0022986 3300049579 Bacteria 4889
116 Ga0501043_0248572 3300049579 Bacteria 1370
117 Ga0501046_0006416 3300049580 Bacteria 10423
118 Ga0501046_0698807 3300049580 Unclassified 715
119 Ga0501047_0020082 3300049581 Bacteria 6415
120 Ga0501048_0397289 3300049582 Bacteria 985
121 Ga0501067_0008308 3300049583 Bacteria 5762
122 Ga0501068_0019369 3300049584 Bacteria 3951
123 Ga0501069_0036791 3300049585 Bacteria 2700
124 Ga0501069_0135130 3300049585 Bacteria 1413
125 Ga0501070_0236673 3300049586 Bacteria 1495
126 Ga0501072_0053174 3300049588 Bacteria 3189
127 Ga0501072_0255821 3300049588 Bacteria 1394
128 Ga0501073_0006463 3300049589 Bacteria 8720
129 Ga0501073_0044241 3300049589 Bacteria 3138
130 Ga0501074_0255687 3300049590 Unclassified 1246
131 Ga0501075_0538302 3300049591 Bacteria 891
132 Ga0501076_0266420 3300049592 Unclassified 1403
133 Ga0501076_0614224 3300049592 Unclassified 897
134 Ga0501077_0242324 3300049593 Unclassified 1146
135 Ga0501217_076163 3300049661 Unclassified 921
136 Ga0501079_0249357 3300049741 Bacteria 1388
137 Ga0501079_0266264 3300049741 Unclassified 1340
138 Ga0501080_0001581 3300049742 Bacteria 19293
139 Ga0501080_0121916 3300049742 Bacteria 2415
140 Ga0501080_1570948 3300049742 Unclassified 558
141 Ga0501083_0078356 3300049744 Bacteria 2192
142 Ga0501083_0094530 3300049744 Bacteria 1973
143 Ga0501083_0216838 3300049744 Bacteria 1247
144 Ga0501035_0020497 3300049822 Bacteria 6073
145 Ga0501035_0133975 3300049822 Bacteria 2158
146 Ga0501044_0007271 3300049823 Bacteria 12167
147 Ga0501044_0842086 3300049823 Bacteria 794
148 nmdc:mga0yw44_24835_c1 3300050492 Bacteria 3397
149 nmdc:mga0yw44_96326_c1 3300050492 Bacteria 1878
150 nmdc:mga05p37_158815_c1 3300050507 Unclassified 2762
151 nmdc:mga08y16_40118_c1 3300050511 Bacteria 4137
152 nmdc:mga0n895_1456435_c1 3300050512 Bacteria 652
153 nmdc:mga0n895_362495_c1 3300050512 Unclassified 1468
154 nmdc:mga0rr50_1103917_c1 3300050513 Bacteria 675
155 nmdc:mga0rr50_82322_c1 3300050513 Bacteria 2486
156 nmdc:mga08x19_13324_c1 3300050514 Bacteria 4968
157 nmdc:mga0a205_1294871_c1 3300050515 Unclassified 577
158 nmdc:mga0a205_707434_c1 3300050515 Bacteria 857
159 Ga0495619_0200809 3300053085 Bacteria 1380
160 Ga0500646_0014167 3300053090 Bacteria 2069
161 Ga0501084_0163942 3300054114 Unclassified 1876
162 Ga0501084_0775184 3300054114 Unclassified 808
163 Ga0501082_0012128 3300060353 Bacteria 7405
164 Ga0501082_0030707 3300060353 Bacteria 4631
165 Ga0501082_1034210 3300060353 Bacteria 718
166 Ga0530510_0333559 3300061734 Unclassified 1138
167 Ga0530510_1541250 3300061734 Unclassified 510
168 Ga0070707_100102094
169 Ga0058861_11241095
170 Ga0065715_10314120
171 Ga0070683_100000062
172 Ga0070683_100531089
173 Ga0070670_100050140
174 Ga0070670_100111361
175 Ga0070660_100163601
176 Ga0070687_100577357
177 Ga0070675_100413058
178 Ga0070671_100153173
179 Ga0070671_100927918
180 Ga0070688_100137254
181 Ga0070667_100977494
182 Ga0070700_100852537
183 Ga0070663_100019690
184 Ga0070678_100215860
185 Ga0070681_10385424
186 Ga0068867_100146655
187 Ga0068867_102046731
188 Ga0070679_100840226
189 Ga0070679_100906688
190 Ga0070684_100000184
191 Ga0068853_101918374
192 Ga0070665_100516583
193 Ga0068859_101383586
194 Ga0068864_101219070
195 Ga0068870_10808942
196 Ga0068863_100007908
197 Ga0068863_101921837
198 Ga0068858_100723999
199 Ga0068860_100536850
200 Ga0081455_10601197
201 Ga0075432_10105960
202 Ga0097621_100006226
203 Ga0068871_100002064
204 Ga0075431_100308760
205 Ga0075431_100575710
206 Ga0075433_10000686
207 Ga0075434_100004777
208 Ga0075434_100430811
209 Ga0075434_101130723
210 Ga0068865_100002557
211 Ga0075436_100019877
212 Ga0097620_101383905
213 Ga0075435_100044115
214 Ga0075435_100143071
215 Ga0099794_10229775
216 Ga0111539_10310801
217 Ga0111539_10362024
218 Ga0105245_10688182
219 Ga0114129_10676056
220 Ga0105243_10360075
221 Ga0105242_10012011
222 Ga0105248_10492665
223 Ga0105248_10663340
224 Ga0105248_11431444
225 Ga0105239_10149573
226 Ga0157372_10784858
227 Ga0163163_10054002
228 Ga0163163_10260189
229 Ga0163163_10496541
230 Ga0157379_10045371
231 Ga0157376_10021067
232 Ga0207657_10092254
233 Ga0207686_10069918
234 Ga0207709_10891238
235 Ga0207670_10659486
236 Ga0207704_10001718
237 Ga0207711_10353203
238 Ga0207661_10003272
239 Ga0207703_10617504
240 Ga0207639_11741855
241 Ga0207708_10899398
242 Ga0207641_10001613
243 Ga0207648_10081810
244 Ga0207676_10007096
245 Ga0207675_100693640
246 Ga0207683_10809049
247 Ga0268266_11822725
248 Ga0307416_100474205
249 Ga0373957_0529078
250 Ga0373955_0233747
251 Ga0373935_0310565
252 Ga0373925_0667419
253 Ga0395898_0959665
254 Ga0450896_027775
255 Ga0466967_0572445
256 Ga0495629_0401629
257 Ga0495628_0336236
258 Ga0495599_0110666
259 Ga0495599_0243799
260 Ga0495647_0180242
261 Ga0495674_0105613
262 Ga0495680_0552052
263 Ga0496104_1083558
264 Ga0496108_0441565
265 Ga0496109_0531994
266 Ga0496112_0854101
267 Ga0496113_0505150
268 Ga0496114_0286209
269 Ga0501031_0065084
270 Ga0501032_0008775
271 Ga0501032_0017869
272 Ga0501034_0051661
273 Ga0501034_0111638
274 Ga0501036_0031938
275 Ga0501036_0093294
276 Ga0501037_0044452
277 Ga0501037_0446662
278 Ga0501038_0006504
279 Ga0501038_0025281
280 Ga0501039_0026015
281 Ga0501039_0104690
282 Ga0501043_0022986
283 Ga0501043_0248572
284 Ga0501046_0006416
285 Ga0501046_0698807
286 Ga0501047_0020082
287 Ga0501048_0397289
288 Ga0501067_0008308
289 Ga0501068_0019369
290 Ga0501069_0036791
291 Ga0501069_0135130
292 Ga0501070_0236673
293 Ga0501072_0053174
294 Ga0501072_0255821
295 Ga0501073_0006463
296 Ga0501073_0044241
297 Ga0501074_0255687
298 Ga0501075_0538302
299 Ga0501076_0266420
300 Ga0501076_0614224
301 Ga0501077_0242324
302 Ga0501217_076163
303 Ga0501079_0249357
304 Ga0501079_0266264
305 Ga0501080_0001581
306 Ga0501080_0121916
307 Ga0501080_1570948
308 Ga0501083_0078356
309 Ga0501083_0094530
310 Ga0501083_0216838
311 Ga0501035_0020497
312 Ga0501035_0133975
313 Ga0501044_0007271
314 Ga0501044_0842086
315 nmdc:mga0yw44_24835_c1
316 nmdc:mga0yw44_96326_c1
317 nmdc:mga05p37_158815_c1
318 nmdc:mga08y16_40118_c1
319 nmdc:mga0n895_1456435_c1
320 nmdc:mga0n895_362495_c1
321 nmdc:mga0rr50_1103917_c1
322 nmdc:mga0rr50_82322_c1
323 nmdc:mga08x19_13324_c1
324 nmdc:mga0a205_1294871_c1
325 nmdc:mga0a205_707434_c1
326 Ga0495619_0200809
327 Ga0500646_0014167
328 Ga0501084_0163942
329 Ga0501084_0775184
330 Ga0501082_0012128
331 Ga0501082_0030707
332 Ga0501082_1034210
333 Ga0530510_0333559
334 Ga0530510_1541250

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

34

162

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fe1-assembly1.cif.gz_A-2 crystal structure of pae0151 from pyrobaculum aerophilum 0.7637 16 145
1v8p-assembly2.cif.gz_F crystal structure of pae2754 from pyrobaculum aerophilum 0.7524 17 150
7by2-assembly1.cif.gz_B-2 toxin-antitoxin complex from klebsiella pneumoniae 0.7516 17 138
2fe1-assembly1.cif.gz_A-2 crystal structure of pae0151 from pyrobaculum aerophilum 0.7377 16 145
4xgq-assembly2.cif.gz_G crystal structure of addiction module from mycobacterial species 0.7353 17 151
ID Description Score Start End Superfamily
af_P64540_3_87_1.10.225.10 Mainly Alpha;Orthogonal Bundle;NK-Lysin;Saposin-like 0.8969 51 83 1.10.225.10
af_P9WF51_3_132_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8862 17 144 3.40.50.1010
af_P9WF51_3_132_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8674 17 144 3.40.50.1010
af_Q9ZUY1_263_441_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8558 52 82 1.25.40.10
af_O50411_2_124_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8363 16 147 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A1Q7JWQ8-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9919 15 151 GO:0000287
GO:0004540
GO:0090729
AF-A0A2V8C204-F1-model_v4 PIN domain-containing protein 0.9749 38 151
AF-A0A1F2SFQ6-F1-model_v4 PIN domain-containing protein 0.9609 17 151
AF-A0A534ZDI7-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 0.954 16 150
AF-A0A6L7KC94-F1-model_v4 deleted 0.9481 16 150

Map