F249371

General Info

Members Datasets Scaffolds Average Seq Length
166 115 332 830

Family's Representative Sequence

Representative Sequence 3300053103|Ga0500555_000375|Ga0500555_000375_4494_7292
Length 932
Sequence MPDWTGHLRPRLAVLRLSPTREAEIVEELSQHLDQRYDELRADGATDHEACRLALEELREPDALAHSMRTLRQADVPPPITPGAPRRFLLADLRQDVRYAARMLRKQPGFTAAAVLTLALGIGANTAIFSLVNATLLQRLQVANRDRLVYAHRGNVGGVFSYPLYAALRDGNHALDGFAAWSSITASLNADNMTDLVNGVIVSGNFFDVLGITAGQGRLLSPSDDVTPGAHPVAAISHELWQTRFGGRPDIVGRDVRLNGHVFTIVGTTPPAFPGPQLGSARHLYVPMMMQAVMRPPGAGYSGEKDPDLLNDRRTRTDGTREYTLSWLFAVGRMKPGITLEQARAELAALATTYERTFEPSDAPERVALVPIDEGDPRQRQRLQGVALLLGGVVAAVLLIACANIANLLLARTASRRRELAVRLAIGASRARLVRQLLTESLLLSCIGGVIGLGLAWAVIQAFRAAPPPPGALPLTIEFSIDQRVLLFSLVLSFLTGILFGIVPALKVSRPGLAPTLKAASAEHDRRGRRFNLQKTLVIAEVALSMLLLIPAGLFVRSLQAARAIDPGIDVERVVSAPLNINLLRYTSVKGREFYRQVVERVASLPGVTTASVGRVPVMAGRGRVSGLMVEGRQGYSGEFGFGEGPGVVTSDSGKINTNVVSPGFFATLGIPLAIGRDFDERDIEGRPLVAIVNEAAVKMHFGGENPIGRRVNFGGQQGPWREVVGVVRNSKYAALGEGALAVAYIPVAQNHQPGMTLYVRTSVPPASLAGSLRREIQRLEPNLPVPNVQTMTETIGSSLYAARMGAWLLGVFGGLALLLAAIGIYGVLSFSTARRTREMGIRLALGAETRSVFLLVVRDGMLLVGAGIIVGLAGXXXGARSLASFLYGVPTSDVATFVAMTTILTAVALVACVIPARRAMRVNPIAALRQE

Samples

Sample ID Description Type Environment
1 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
85 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
86 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
87 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
88 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
89 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
90 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
91 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
92 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
93 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
94 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
95 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
99 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
100 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
101 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
102 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
103 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
104 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
105 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
106 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
107 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
108 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
109 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
110 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
111 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
112 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
113 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
114 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
115 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 1.2
Rhizosphere 98.19
Stem 0
Stem Tuber 0
Unclassified 3.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500555_000375 3300053103 Bacteria 18901
2 Ga0065712_10001231 3300005290 Bacteria 9475
3 Ga0070676_10016723 3300005328 Bacteria 4056
4 Ga0070670_100004388 3300005331 Bacteria 11814
5 Ga0070670_100008629 3300005331 Bacteria 8699
6 Ga0068869_100009213 3300005334 Bacteria 6396
7 Ga0070689_100001843 3300005340 Bacteria 13659
8 Ga0070689_100075157 3300005340 Bacteria 2645
9 Ga0070687_100008395 3300005343 Bacteria 4374
10 Ga0070669_100027558 3300005353 Bacteria 4089
11 Ga0070671_100021245 3300005355 Bacteria 5302
12 Ga0070673_100002295 3300005364 Bacteria 11612
13 Ga0070673_100003403 3300005364 Bacteria 9900
14 Ga0070673_100024289 3300005364 Bacteria 4442
15 Ga0070667_100032179 3300005367 Bacteria 4374
16 Ga0070667_100038295 3300005367 Bacteria 4020
17 Ga0070714_100006796 3300005435 Bacteria 8867
18 Ga0070713_100025296 3300005436 Unclassified 4639
19 Ga0070711_100000001 3300005439 Bacteria 370591
20 Ga0070705_100012038 3300005440 Bacteria 4383
21 Ga0070694_100000570 3300005444 Bacteria 20432
22 Ga0070708_100002026 3300005445 Bacteria 15596
23 Ga0070662_100003350 3300005457 Bacteria 9992
24 Ga0070706_100007442 3300005467 Bacteria 10266
25 Ga0070706_100052589 3300005467 Bacteria 3759
26 Ga0070707_100001718 3300005468 Bacteria 21122
27 Ga0070707_100013613 3300005468 Bacteria 7616
28 Ga0070698_100001514 3300005471 Bacteria 25762
29 Ga0070698_100005630 3300005471 Bacteria 13707
30 Ga0070698_100013622 3300005471 Bacteria 8609
31 Ga0070699_100002015 3300005518 Bacteria 18360
32 Ga0070699_100025760 3300005518 Bacteria 5069
33 Ga0070697_100000216 3300005536 Bacteria 47410
34 Ga0070697_100007093 3300005536 Bacteria 8716
35 Ga0070672_100012037 3300005543 Bacteria 6054
36 Ga0070665_100003625 3300005548 Bacteria 16355
37 Ga0068866_10005893 3300005718 Bacteria 5091
38 Ga0068863_100000285 3300005841 Bacteria 52358
39 Ga0068862_100010661 3300005844 Bacteria 7593
40 Ga0081455_10050274 3300005937 Bacteria 3586
41 Ga0070717_10008171 3300006028 Bacteria 7811
42 Ga0097621_100009146 3300006237 Bacteria 7181
43 Ga0068871_100002548 3300006358 Bacteria 12435
44 Ga0075428_100005939 3300006844 Bacteria 13568
45 Ga0075428_100020770 3300006844 Bacteria 7271
46 Ga0075428_100125702 3300006844 Bacteria 2791
47 Ga0075430_100007510 3300006846 Bacteria 9203
48 Ga0075431_100050216 3300006847 Bacteria 4301
49 Ga0075433_10001430 3300006852 Bacteria 17606
50 Ga0075434_100016641 3300006871 Bacteria 7071
51 Ga0075434_100057863 3300006871 Unclassified 3852
52 Ga0075429_100010911 3300006880 Bacteria 7860
53 Ga0075429_100013365 3300006880 Bacteria 7119
54 Ga0075429_100021324 3300006880 Bacteria 5616
55 Ga0097620_100016707 3300006931 Bacteria 7369
56 Ga0075435_100005098 3300007076 Bacteria 9132
57 Ga0075435_100007788 3300007076 Bacteria 7659
58 Ga0105240_10000235 3300009093 Bacteria 110217
59 Ga0105240_10004985 3300009093 Bacteria 19947
60 Ga0105240_10007227 3300009093 Bacteria 16170
61 Ga0105240_10104376 3300009093 Bacteria 3442
62 Ga0111539_10001614 3300009094 Bacteria 30118
63 Ga0111539_10037916 3300009094 Bacteria 5815
64 Ga0111539_10038866 3300009094 Bacteria 5740
65 Ga0105245_10000286 3300009098 Bacteria 48236
66 Ga0114129_10049477 3300009147 Bacteria 5905
67 Ga0105242_10000008 3300009176 Bacteria 172348
68 Ga0105242_10000425 3300009176 Bacteria 33730
69 Ga0105242_10034679 3300009176 Bacteria 4045
70 Ga0105248_10037257 3300009177 Bacteria 5441
71 Ga0105248_10080037 3300009177 Bacteria 3672
72 Ga0105237_10008962 3300009545 Bacteria 10770
73 Ga0105239_10006210 3300010375 Bacteria 13902
74 Ga0105239_10048191 3300010375 Bacteria 4672
75 Ga0157378_10000023 3300013297 Bacteria 129977
76 Ga0157378_10026137 3300013297 Bacteria 5146
77 Ga0163162_10033841 3300013306 Bacteria 5080
78 Ga0163162_10057501 3300013306 Bacteria 3918
79 Ga0157375_10009445 3300013308 Bacteria 8562
80 Ga0163163_10013119 3300014325 Bacteria 7570
81 Ga0157380_10010986 3300014326 Bacteria 6529
82 Ga0157376_10023621 3300014969 Bacteria 4815
83 Ga0207697_10003011 3300025315 Bacteria 8478
84 Ga0207645_10011025 3300025907 Bacteria 6185
85 Ga0207684_10000424 3300025910 Bacteria 56172
86 Ga0207695_10000047 3300025913 Bacteria 422459
87 Ga0207695_10004323 3300025913 Bacteria 19453
88 Ga0207695_10056543 3300025913 Bacteria 4081
89 Ga0207671_10007129 3300025914 Bacteria 9757
90 Ga0207662_10008654 3300025918 Bacteria 5582
91 Ga0207646_10000605 3300025922 Bacteria 46647
92 Ga0207646_10018736 3300025922 Bacteria 6451
93 Ga0207681_10007999 3300025923 Bacteria 6466
94 Ga0207681_10018865 3300025923 Bacteria 4350
95 Ga0207650_10003062 3300025925 Bacteria 11522
96 Ga0207659_10027338 3300025926 Bacteria 3862
97 Ga0207700_10039560 3300025928 Unclassified 3434
98 Ga0207664_10029274 3300025929 Bacteria 4193
99 Ga0207706_10006739 3300025933 Bacteria 10621
100 Ga0207686_10000023 3300025934 Bacteria 172422
101 Ga0207686_10000587 3300025934 Bacteria 22804
102 Ga0207709_10000062 3300025935 Bacteria 194534
103 Ga0207670_10000190 3300025936 Bacteria 40610
104 Ga0207691_10015499 3300025940 Bacteria 7246
105 Ga0207689_10004238 3300025942 Bacteria 13047
106 Ga0207689_10011061 3300025942 Bacteria 7754
107 Ga0207658_10044323 3300025986 Unclassified 3238
108 Ga0207677_10014549 3300026023 Bacteria 4599
109 Ga0207708_10007291 3300026075 Bacteria 8177
110 Ga0207641_10000279 3300026088 Bacteria 64308
111 Ga0207641_10017596 3300026088 Bacteria 5852
112 Ga0207675_100085760 3300026118 Bacteria 2956
113 Ga0207683_10044344 3300026121 Unclassified 3888
114 Ga0207428_10003512 3300027907 Bacteria 15174
115 Ga0207428_10006878 3300027907 Bacteria 10424
116 Ga0207428_10007880 3300027907 Bacteria 9686
117 Ga0207428_10010157 3300027907 Bacteria 8418
118 Ga0268266_10005036 3300028379 Bacteria 12474
119 Ga0268265_10007205 3300028380 Bacteria 7515
120 Ga0307408_100013266 3300031548 Bacteria 5469
121 Ga0307416_100074774 3300032002 Bacteria 2832
122 Ga0373948_0001875 3300034817 Bacteria 3006
123 Ga0373938_0000145 3300034957 Bacteria 10311
124 Ga0373929_0001760 3300035085 Bacteria 4068
125 Ga0373949_0000834 3300035090 Bacteria 9828
126 Ga0373952_0000474 3300035092 Bacteria 6988
127 Ga0373932_0001039 3300035112 Bacteria 8012
128 Ga0373939_0000452 3300035114 Bacteria 10367
129 Ga0373941_0000033 3300035115 Bacteria 20774
130 Ga0373960_0001491 3300035121 Bacteria 5195
131 Ga0373942_0000523 3300035207 Bacteria 10741
132 Ga0373961_0000808 3300035241 Bacteria 10698
133 Ga0373931_0000354 3300035691 Bacteria 18866
134 Ga0373927_0001859 3300035695 Bacteria 15641
135 Ga0373925_0005457 3300037068 Bacteria 9472
136 Ga0453683_0027860 3300044673 Bacteria 3580
137 Ga0495580_0000042 3300046472 Bacteria 70551
138 Ga0495580_0018150 3300046472 Bacteria 5243
139 Ga0495645_0010584 3300046543 Bacteria 6474
140 Ga0495645_0043293 3300046543 Bacteria 3284
141 Ga0495667_0021262 3300046559 Bacteria 4378
142 Ga0495623_0022805 3300046679 Bacteria 4042
143 Ga0495684_0000267 3300047471 Bacteria 41592
144 Ga0496104_0029852 3300048907 Bacteria 5062
145 Ga0496106_0057116 3300048909 Bacteria 2951
146 nmdc:mga05p37_54_c2 3300050507 Bacteria 73831
147 nmdc:mga05p37_67293_c1 3300050507 Bacteria 4407
148 nmdc:mga09592_11262_c1 3300050508 Bacteria 7276
149 nmdc:mga09592_15325_c1 3300050508 Bacteria 6260
150 nmdc:mga09592_23840_c1 3300050508 Bacteria 5057
151 nmdc:mga09592_25730_c1 3300050508 Bacteria 4872
152 nmdc:mga0qj67_16027_c1 3300050509 Bacteria 5676
153 nmdc:mga0qj67_2651_c1 3300050509 Bacteria 12822
154 nmdc:mga06r32_19299_c1 3300050510 Bacteria 6256
155 nmdc:mga06r32_23935_c1 3300050510 Bacteria 5659
156 nmdc:mga06r32_5060_c1 3300050510 Bacteria 11874
157 nmdc:mga06r32_78282_c1 3300050510 Unclassified 3213
158 nmdc:mga08y16_1336_c1 3300050511 Bacteria 24575
159 nmdc:mga08y16_566_c1 3300050511 Bacteria 34372
160 nmdc:mga0rr50_21626_c1 3300050513 Bacteria 4396
161 nmdc:mga08x19_27153_c1 3300050514 Bacteria 3579
162 nmdc:mga0a205_62433_c1 3300050515 Bacteria 3599
163 nmdc:mga0a205_7948_c1 3300050515 Bacteria 9632
164 nmdc:mga0a205_9063_c1 3300050515 Bacteria 9077
165 Ga0590071_000116 3300059421 Bacteria 22708
166 Ga0590075_002164 3300059424 Bacteria 4724
167 Ga0500555_000375
168 Ga0065712_10001231
169 Ga0070676_10016723
170 Ga0070670_100004388
171 Ga0070670_100008629
172 Ga0068869_100009213
173 Ga0070689_100001843
174 Ga0070689_100075157
175 Ga0070687_100008395
176 Ga0070669_100027558
177 Ga0070671_100021245
178 Ga0070673_100002295
179 Ga0070673_100003403
180 Ga0070673_100024289
181 Ga0070667_100032179
182 Ga0070667_100038295
183 Ga0070714_100006796
184 Ga0070713_100025296
185 Ga0070711_100000001
186 Ga0070705_100012038
187 Ga0070694_100000570
188 Ga0070708_100002026
189 Ga0070662_100003350
190 Ga0070706_100007442
191 Ga0070706_100052589
192 Ga0070707_100001718
193 Ga0070707_100013613
194 Ga0070698_100001514
195 Ga0070698_100005630
196 Ga0070698_100013622
197 Ga0070699_100002015
198 Ga0070699_100025760
199 Ga0070697_100000216
200 Ga0070697_100007093
201 Ga0070672_100012037
202 Ga0070665_100003625
203 Ga0068866_10005893
204 Ga0068863_100000285
205 Ga0068862_100010661
206 Ga0081455_10050274
207 Ga0070717_10008171
208 Ga0097621_100009146
209 Ga0068871_100002548
210 Ga0075428_100005939
211 Ga0075428_100020770
212 Ga0075428_100125702
213 Ga0075430_100007510
214 Ga0075431_100050216
215 Ga0075433_10001430
216 Ga0075434_100016641
217 Ga0075434_100057863
218 Ga0075429_100010911
219 Ga0075429_100013365
220 Ga0075429_100021324
221 Ga0097620_100016707
222 Ga0075435_100005098
223 Ga0075435_100007788
224 Ga0105240_10000235
225 Ga0105240_10004985
226 Ga0105240_10007227
227 Ga0105240_10104376
228 Ga0111539_10001614
229 Ga0111539_10037916
230 Ga0111539_10038866
231 Ga0105245_10000286
232 Ga0114129_10049477
233 Ga0105242_10000008
234 Ga0105242_10000425
235 Ga0105242_10034679
236 Ga0105248_10037257
237 Ga0105248_10080037
238 Ga0105237_10008962
239 Ga0105239_10006210
240 Ga0105239_10048191
241 Ga0157378_10000023
242 Ga0157378_10026137
243 Ga0163162_10033841
244 Ga0163162_10057501
245 Ga0157375_10009445
246 Ga0163163_10013119
247 Ga0157380_10010986
248 Ga0157376_10023621
249 Ga0207697_10003011
250 Ga0207645_10011025
251 Ga0207684_10000424
252 Ga0207695_10000047
253 Ga0207695_10004323
254 Ga0207695_10056543
255 Ga0207671_10007129
256 Ga0207662_10008654
257 Ga0207646_10000605
258 Ga0207646_10018736
259 Ga0207681_10007999
260 Ga0207681_10018865
261 Ga0207650_10003062
262 Ga0207659_10027338
263 Ga0207700_10039560
264 Ga0207664_10029274
265 Ga0207706_10006739
266 Ga0207686_10000023
267 Ga0207686_10000587
268 Ga0207709_10000062
269 Ga0207670_10000190
270 Ga0207691_10015499
271 Ga0207689_10004238
272 Ga0207689_10011061
273 Ga0207658_10044323
274 Ga0207677_10014549
275 Ga0207708_10007291
276 Ga0207641_10000279
277 Ga0207641_10017596
278 Ga0207675_100085760
279 Ga0207683_10044344
280 Ga0207428_10003512
281 Ga0207428_10006878
282 Ga0207428_10007880
283 Ga0207428_10010157
284 Ga0268266_10005036
285 Ga0268265_10007205
286 Ga0307408_100013266
287 Ga0307416_100074774
288 Ga0373948_0001875
289 Ga0373938_0000145
290 Ga0373929_0001760
291 Ga0373949_0000834
292 Ga0373952_0000474
293 Ga0373932_0001039
294 Ga0373939_0000452
295 Ga0373941_0000033
296 Ga0373960_0001491
297 Ga0373942_0000523
298 Ga0373961_0000808
299 Ga0373931_0000354
300 Ga0373927_0001859
301 Ga0373925_0005457
302 Ga0453683_0027860
303 Ga0495580_0000042
304 Ga0495580_0018150
305 Ga0495645_0010584
306 Ga0495645_0043293
307 Ga0495667_0021262
308 Ga0495623_0022805
309 Ga0495684_0000267
310 Ga0496104_0029852
311 Ga0496106_0057116
312 nmdc:mga05p37_54_c2
313 nmdc:mga05p37_67293_c1
314 nmdc:mga09592_11262_c1
315 nmdc:mga09592_15325_c1
316 nmdc:mga09592_23840_c1
317 nmdc:mga09592_25730_c1
318 nmdc:mga0qj67_16027_c1
319 nmdc:mga0qj67_2651_c1
320 nmdc:mga06r32_19299_c1
321 nmdc:mga06r32_23935_c1
322 nmdc:mga06r32_5060_c1
323 nmdc:mga06r32_78282_c1
324 nmdc:mga08y16_1336_c1
325 nmdc:mga08y16_566_c1
326 nmdc:mga0rr50_21626_c1
327 nmdc:mga08x19_27153_c1
328 nmdc:mga0a205_62433_c1
329 nmdc:mga0a205_7948_c1
330 nmdc:mga0a205_9063_c1
331 Ga0590071_000116
332 Ga0590075_002164

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02687

FtsX

FtsX-like permease family

391

513

0.96

PF02687

FtsX

FtsX-like permease family

811

925

0.93

PF12704

MacB_PCD

MacB-like periplasmic core domain

111

350

0.75

PF12704

MacB_PCD

MacB-like periplasmic core domain

591

780

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w7c-assembly1.cif.gz_B-2 heme exporter in the unliganded form 0.8475 763 882
8tzj-assembly1.cif.gz_D cryo-em structure of vibrio cholerae ftse/ftsx complex 0.8104 750 878
3is6-assembly1.cif.gz_B the crystal structure of a domain of a putative permease protein from porphyromonas gingivalis to 2a 0.7565 125 340
3is6-assembly1.cif.gz_A the crystal structure of a domain of a putative permease protein from porphyromonas gingivalis to 2a 0.7291 125 340
3is6-assembly1.cif.gz_B the crystal structure of a domain of a putative permease protein from porphyromonas gingivalis to 2a 0.7037 125 340
ID Description Score Start End Superfamily
2iruB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.5408 292 342 3.30.70.3300
af_P9WNV3_16_301_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.4664 292 350 3.90.920.10
af_B0UYT6_64_335_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.4323 707 770 3.40.640.10
af_P37340_17_177_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4083 313 487 1.10.1760.20
af_P37340_17_177_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.3988 313 487 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A2V8G5J6-F1-model_v4 Permease 0.9413 77 884 GO:0005886
GO:0022857
AF-A0A2V8G5J6-F1-model_v4 Permease 0.938 77 884 GO:0005886
GO:0022857
AF-A0A2V9J8C7-F1-model_v4 ABC transporter permease 0.9273 354 884 GO:0005886
GO:0022857
AF-A0A1Q7KIZ9-F1-model_v4 Permease 0.9221 361 884 GO:0005886
GO:0022857
AF-A0A1Q7GPF1-F1-model_v4 ABC transporter permease 0.9213 69 883 GO:0005886
GO:0022857

Map