F249079

General Info

Members Datasets Scaffolds Average Seq Length
166 123 332 471

Family's Representative Sequence

Representative Sequence 3300046615|Ga0495656_0004141|Ga0495656_0004141_1562_3109
Length 509
Sequence VTFFETDGDAGLLSPVSASPLVAALTGDRAVLAAILKVEAAWAAVLDDAGLAPAGSAAVVAAAADVQRYDVAGIAVRAQGGGNPVIPLIADLREQVKALDDAGLGAAQAVHTSLTSQDVLDSALMVLAAGALRELLAELRAATAALAGLAEAHAHTLCVARSLTQHSLPYTFGLRAAQWFNGLAAAASRLEALELPVQTGGAAGTLAAGTVLTDGIGLAGAGLNADTALTAGPLSPFDLADRLAARLGLATVPAPWHTNRLAVTSLGDALAAVTDAAGKMAADVLFLSRPEVAEIAEPRVAGRGVSSAMPQKQNPVLSVLIRSAALQAPALAAQLHLAAANFNDERPDGAWHSEWAALRQLLRLALGAAAQLRELAEGMTVFPGAMRRNLELAGPLLLSEAVNAAVAPLLDGRGAGTGAGRTGKRRLQAVVDETLQAPAAEQSDTYRALLRAAVPEELLTDARLEELLNPANYLGQAVEISRRILAAYPEYAGPAGAIAHQLQNGASRG

Samples

Sample ID Description Type Environment
1 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
12 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
13 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
14 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
15 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
16 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
17 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
18 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
19 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
20 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
21 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
22 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
23 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
30 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
31 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
32 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
33 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
34 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
35 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
36 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
37 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
38 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
39 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
40 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
41 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
42 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
43 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
44 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
45 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
46 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
47 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
48 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
49 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
50 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
51 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
52 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
53 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
54 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
55 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
56 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
57 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
58 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
59 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
60 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
61 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
62 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
63 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
64 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
65 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
66 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
67 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
68 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
69 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
70 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
71 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
72 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
73 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
74 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
75 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
76 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
77 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
78 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
79 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
80 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
81 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
82 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
89 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
90 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
91 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
92 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
93 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
94 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
95 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
96 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
97 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
98 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
99 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
100 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
101 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
102 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
103 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
104 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
105 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
106 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
107 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
108 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
109 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
110 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
111 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
112 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
113 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
114 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
115 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
116 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
117 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
118 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
119 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
120 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
121 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
122 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
123 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.92
Metatranscriptomes 0
Isolates 21.08

Biome Distribution

Category Percentage (%)
Aerial Root 1.2
Bulb 0
Endosphere 3.61
Nodule 0
Rhizoplane 9.04
Rhizosphere 77.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495656_0004141 3300046615 Bacteria 4941
2 LJQas_1001986 3300000549 Bacteria 2946
3 JGI25152J39213_1002262 3300002773 Bacteria 7435
4 rootL2_10100372 3300003322 Bacteria 5389
5 Ga0070670_100081971 3300005331 Bacteria 2772
6 Ga0070677_10004468 3300005333 Bacteria 4571
7 Ga0070669_100013758 3300005353 Bacteria 5752
8 Ga0070675_100142270 3300005354 Bacteria 2051
9 Ga0070671_100030173 3300005355 Bacteria 4474
10 Ga0070667_100042179 3300005367 Bacteria 3828
11 Ga0075432_10017700 3300006058 Bacteria 2429
12 Ga0105251_10012455 3300009011 Bacteria 4812
13 Ga0105243_10085823 3300009148 Bacteria 2581
14 Ga0105248_10109405 3300009177 Bacteria 3116
15 Ga0105249_10116470 3300009553 Bacteria 2533
16 Ga0105246_10003487 3300011119 Bacteria 9535
17 Ga0157373_10025243 3300013100 Bacteria 4300
18 Ga0163162_10244861 3300013306 Bacteria 1924
19 Ga0209148_1002963 3300025254 Bacteria 5126
20 Ga0209148_1005131 3300025254 Bacteria 3060
21 Ga0209129_1000130 3300025258 Bacteria 128065
22 Ga0209025_1000364 3300025294 Bacteria 96280
23 Ga0209051_1008385 3300025303 Bacteria 5476
24 Ga0207697_10000682 3300025315 Bacteria 19316
25 Ga0207697_10001251 3300025315 Bacteria 13930
26 Ga0207682_10000461 3300025893 Bacteria 18790
27 Ga0207645_10000166 3300025907 Bacteria 52485
28 Ga0207643_10017675 3300025908 Bacteria 3902
29 Ga0207687_10141276 3300025927 Bacteria 1827
30 Ga0207683_10001855 3300026121 Bacteria 18682
31 Ga0207428_10046865 3300027907 Bacteria 3474
32 Ga0307408_100005774 3300031548 Bacteria 8247
33 Ga0307408_100014809 3300031548 Bacteria 5185
34 Ga0307408_100021282 3300031548 Bacteria 4387
35 Ga0307408_100051925 3300031548 Bacteria 2956
36 Ga0307405_10006523 3300031731 Bacteria 5747
37 Ga0307405_10083090 3300031731 Bacteria 2098
38 Ga0307413_10039282 3300031824 Bacteria 2751
39 Ga0307410_10033347 3300031852 Bacteria 3324
40 Ga0307410_10049780 3300031852 Bacteria 2814
41 Ga0307410_10067354 3300031852 Bacteria 2470
42 Ga0307406_10052860 3300031901 Bacteria 2586
43 Ga0307407_10008713 3300031903 Bacteria 4675
44 Ga0307407_10067900 3300031903 Bacteria 2109
45 Ga0307412_10004203 3300031911 Bacteria 8033
46 Ga0307412_10005460 3300031911 Bacteria 7136
47 Ga0307412_10007987 3300031911 Bacteria 6032
48 Ga0307412_10022269 3300031911 Bacteria 3882
49 Ga0307412_10025656 3300031911 Bacteria 3652
50 Ga0307412_10028350 3300031911 Bacteria 3501
51 Ga0307412_10096854 3300031911 Bacteria 2077
52 Ga0307409_100006389 3300031995 Bacteria 6919
53 Ga0307416_100012851 3300032002 Bacteria 5663
54 Ga0307416_100014184 3300032002 Bacteria 5447
55 Ga0307416_100034661 3300032002 Bacteria 3844
56 Ga0307416_100037209 3300032002 Bacteria 3742
57 Ga0307416_100060431 3300032002 Bacteria 3086
58 Ga0307416_100094835 3300032002 Bacteria 2574
59 Ga0307416_100189349 3300032002 Bacteria 1938
60 Ga0307415_100070080 3300032126 Bacteria 2461
61 Ga0395899_0008495 3300037312 Bacteria 7911
62 Ga0395900_0008192 3300037418 Bacteria 10758
63 Ga0395900_0026703 3300037418 Bacteria 5911
64 Ga0395898_0035581 3300037466 Bacteria 4949
65 Ga0395898_0050676 3300037466 Bacteria 4062
66 Ga0395901_0044866 3300038443 Bacteria 4585
67 Ga0395901_0050588 3300038443 Bacteria 4316
68 Ga0395901_0129882 3300038443 Bacteria 2647
69 Ga0395901_0303490 3300038443 Bacteria 1655
70 Ga0439436_0006825 3300041404 Bacteria 3507
71 Ga0439436_0032135 3300041404 Bacteria 1523
72 Ga0439466_0026231 3300041411 Bacteria 2028
73 Ga0439465_0011168 3300041413 Bacteria 2818
74 Ga0439442_000251 3300042002 Bacteria 13066
75 Ga0439442_000621 3300042002 Bacteria 7630
76 Ga0439442_000901 3300042002 Bacteria 6118
77 Ga0439449_0003330 3300042007 Bacteria 6268
78 Ga0439449_0012240 3300042007 Bacteria 3224
79 Ga0439449_0015137 3300042007 Bacteria 2898
80 Ga0439457_010951 3300042014 Bacteria 2073
81 Ga0450920_000382 3300042122 Bacteria 6889
82 Ga0450907_000232 3300042146 Bacteria 19464
83 Ga0439434_0000012 3300042435 Bacteria 46644
84 Ga0450918_000225 3300042531 Bacteria 13017
85 Ga0466965_0065785 3300044683 Bacteria 1817
86 Ga0495653_0002069 3300046463 Bacteria 15779
87 Ga0495582_0034893 3300046473 Bacteria 2765
88 Ga0495639_0019089 3300046475 Bacteria 2991
89 Ga0495662_0003659 3300046476 Bacteria 7751
90 Ga0495594_0037476 3300046499 Bacteria 2645
91 Ga0495665_0000160 3300046531 Bacteria 33594
92 Ga0495665_0021412 3300046531 Bacteria 3473
93 Ga0495586_0007571 3300046535 Bacteria 5793
94 Ga0495586_0017261 3300046535 Bacteria 3836
95 Ga0495587_0006877 3300046536 Bacteria 7393
96 Ga0495645_0000355 3300046543 Bacteria 31940
97 Ga0495659_0009453 3300046664 Bacteria 3112
98 Ga0495588_0006637 3300046674 Bacteria 5223
99 Ga0495588_0010983 3300046674 Bacteria 4237
100 Ga0495657_0016879 3300046675 Bacteria 5308
101 Ga0495670_0032570 3300046691 Bacteria 2592
102 Ga0495600_0008719 3300046809 Bacteria 6238
103 Ga0495600_0067780 3300046809 Bacteria 2332
104 Ga0495581_0034959 3300047315 Bacteria 2907
105 Ga0495680_0008798 3300047322 Bacteria 9147
106 Ga0496100_0081642 3300048903 Bacteria 2184
107 Ga0496101_0015651 3300048904 Bacteria 5117
108 Ga0496102_0033939 3300048905 Bacteria 4588
109 Ga0496102_0105191 3300048905 Bacteria 2625
110 Ga0496103_0035909 3300048906 Bacteria 3034
111 Ga0496103_0063850 3300048906 Bacteria 2294
112 Ga0496103_0083717 3300048906 Bacteria 2008
113 Ga0496106_0012470 3300048909 Bacteria 6276
114 Ga0496106_0134952 3300048909 Bacteria 1937
115 Ga0496107_0002875 3300048910 Bacteria 11381
116 Ga0496108_0244019 3300048911 Bacteria 1562
117 Ga0496109_0079546 3300048912 Bacteria 3020
118 Ga0496112_0012906 3300048915 Bacteria 7695
119 Ga0496114_0077334 3300048917 Bacteria 2805
120 Ga0496115_0022819 3300048918 Bacteria 4852
121 Ga0501032_0008292 3300049569 Bacteria 7572
122 Ga0501034_0000038 3300049571 Bacteria 237795
123 Ga0501037_0009369 3300049573 Bacteria 7187
124 Ga0501037_0013369 3300049573 Bacteria 6046
125 Ga0501037_0018390 3300049573 Bacteria 5151
126 Ga0501038_0004341 3300049574 Bacteria 13188
127 Ga0501038_0047845 3300049574 Bacteria 3703
128 Ga0501038_0056313 3300049574 Bacteria 3376
129 Ga0501039_0024371 3300049575 Bacteria 4647
130 Ga0501043_0027485 3300049579 Bacteria 4466
131 Ga0501073_0158718 3300049589 Bacteria 1567
132 2691511920 2690315906 Bacteria 4517044
133 2775657158 2775506735 Bacteria 4556596
134 2808829095 2808606357 Bacteria 4466944
135 2808850320 2808606360 Bacteria 4404006
136 2808877127 2808606366 Bacteria 4415912
137 2808893334 2808606370 Bacteria 4942454
138 2808898590 2808606371 Bacteria 4251511
139 2812319165 2811994871 Bacteria 4497550
140 2844850748 2844849076 Bacteria 4091819
141 2857744090 2857740372 Bacteria 4782044
142 2904498880 2904497146 Bacteria 4731781
143 2904780173 2904776348 Bacteria 4658726
144 2905929887 2905926851 Bacteria 4423176
145 2910813756 2910809715 Bacteria 4982797
146 2919036794 2919034639 Bacteria 4763403
147 2919061158 2919059106 Bacteria 4991624
148 2919392704 2919391150 Bacteria 4884741
149 2919541563 2919538618 Bacteria 4677069
150 2932429647 2932426870 Bacteria 4547726
151 2933420384 2933418574 Bacteria 4476724
152 2939601813 2939598168 Bacteria 4687164
153 2939649791 2939647034 Bacteria 4681660
154 2939677842 2939674588 Bacteria 4844420
155 2945916927 2945916053 Bacteria 4555517
156 2945922827 2945920336 Bacteria 4501603
157 2945945392 2945941187 Bacteria 4682474
158 2945956313 2945956166 Bacteria 5110334
159 2946027085 2946024296 Bacteria 3508095
160 2946041480 2946037020 Bacteria 4900426
161 2946060751 2946059875 Bacteria 4386623
162 2954002683 2953998280 Bacteria 4812144
163 2974304916 2974302888 Bacteria 4369871
164 2984577795 2984576629 Bacteria 4248407
165 2990260234 2990256926 Bacteria 4252839
166 8054109822 8054107350 Bacteria 5022511
167 Ga0495656_0004141
168 LJQas_1001986
169 JGI25152J39213_1002262
170 rootL2_10100372
171 Ga0070670_100081971
172 Ga0070677_10004468
173 Ga0070669_100013758
174 Ga0070675_100142270
175 Ga0070671_100030173
176 Ga0070667_100042179
177 Ga0075432_10017700
178 Ga0105251_10012455
179 Ga0105243_10085823
180 Ga0105248_10109405
181 Ga0105249_10116470
182 Ga0105246_10003487
183 Ga0157373_10025243
184 Ga0163162_10244861
185 Ga0209148_1002963
186 Ga0209148_1005131
187 Ga0209129_1000130
188 Ga0209025_1000364
189 Ga0209051_1008385
190 Ga0207697_10000682
191 Ga0207697_10001251
192 Ga0207682_10000461
193 Ga0207645_10000166
194 Ga0207643_10017675
195 Ga0207687_10141276
196 Ga0207683_10001855
197 Ga0207428_10046865
198 Ga0307408_100005774
199 Ga0307408_100014809
200 Ga0307408_100021282
201 Ga0307408_100051925
202 Ga0307405_10006523
203 Ga0307405_10083090
204 Ga0307413_10039282
205 Ga0307410_10033347
206 Ga0307410_10049780
207 Ga0307410_10067354
208 Ga0307406_10052860
209 Ga0307407_10008713
210 Ga0307407_10067900
211 Ga0307412_10004203
212 Ga0307412_10005460
213 Ga0307412_10007987
214 Ga0307412_10022269
215 Ga0307412_10025656
216 Ga0307412_10028350
217 Ga0307412_10096854
218 Ga0307409_100006389
219 Ga0307416_100012851
220 Ga0307416_100014184
221 Ga0307416_100034661
222 Ga0307416_100037209
223 Ga0307416_100060431
224 Ga0307416_100094835
225 Ga0307416_100189349
226 Ga0307415_100070080
227 Ga0395899_0008495
228 Ga0395900_0008192
229 Ga0395900_0026703
230 Ga0395898_0035581
231 Ga0395898_0050676
232 Ga0395901_0044866
233 Ga0395901_0050588
234 Ga0395901_0129882
235 Ga0395901_0303490
236 Ga0439436_0006825
237 Ga0439436_0032135
238 Ga0439466_0026231
239 Ga0439465_0011168
240 Ga0439442_000251
241 Ga0439442_000621
242 Ga0439442_000901
243 Ga0439449_0003330
244 Ga0439449_0012240
245 Ga0439449_0015137
246 Ga0439457_010951
247 Ga0450920_000382
248 Ga0450907_000232
249 Ga0439434_0000012
250 Ga0450918_000225
251 Ga0466965_0065785
252 Ga0495653_0002069
253 Ga0495582_0034893
254 Ga0495639_0019089
255 Ga0495662_0003659
256 Ga0495594_0037476
257 Ga0495665_0000160
258 Ga0495665_0021412
259 Ga0495586_0007571
260 Ga0495586_0017261
261 Ga0495587_0006877
262 Ga0495645_0000355
263 Ga0495659_0009453
264 Ga0495588_0006637
265 Ga0495588_0010983
266 Ga0495657_0016879
267 Ga0495670_0032570
268 Ga0495600_0008719
269 Ga0495600_0067780
270 Ga0495581_0034959
271 Ga0495680_0008798
272 Ga0496100_0081642
273 Ga0496101_0015651
274 Ga0496102_0033939
275 Ga0496102_0105191
276 Ga0496103_0035909
277 Ga0496103_0063850
278 Ga0496103_0083717
279 Ga0496106_0012470
280 Ga0496106_0134952
281 Ga0496107_0002875
282 Ga0496108_0244019
283 Ga0496109_0079546
284 Ga0496112_0012906
285 Ga0496114_0077334
286 Ga0496115_0022819
287 Ga0501032_0008292
288 Ga0501034_0000038
289 Ga0501037_0009369
290 Ga0501037_0013369
291 Ga0501037_0018390
292 Ga0501038_0004341
293 Ga0501038_0047845
294 Ga0501038_0056313
295 Ga0501039_0024371
296 Ga0501043_0027485
297 Ga0501073_0158718
298 2691511920
299 2775657158
300 2808829095
301 2808850320
302 2808877127
303 2808893334
304 2808898590
305 2812319165
306 2844850748
307 2857744090
308 2904498880
309 2904780173
310 2905929887
311 2910813756
312 2919036794
313 2919061158
314 2919392704
315 2919541563
316 2932429647
317 2933420384
318 2939601813
319 2939649791
320 2939677842
321 2945916927
322 2945922827
323 2945945392
324 2945956313
325 2946027085
326 2946041480
327 2946060751
328 2954002683
329 2974304916
330 2984577795
331 2990260234
332 8054109822

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00206

Lyase_1

Lyase

16

329

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
1re5-assembly1.cif.gz_D crystal structure of 3-carboxy-cis,cis-muconate lactonizing enzyme from pseudomonas putida 0.8888 32 478
1re5-assembly1.cif.gz_C crystal structure of 3-carboxy-cis,cis-muconate lactonizing enzyme from pseudomonas putida 0.8876 32 478
1re5-assembly1.cif.gz_A crystal structure of 3-carboxy-cis,cis-muconate lactonizing enzyme from pseudomonas putida 0.887 32 478
5xnz-assembly1.cif.gz_A crystal structure of cred complex with fumarate 0.8864 22 471
1re5-assembly1.cif.gz_B crystal structure of 3-carboxy-cis,cis-muconate lactonizing enzyme from pseudomonas putida 0.8855 32 478
ID Description Score Start End Superfamily
1re5B01 Mainly Alpha;Orthogonal Bundle;Fumarase C; Chain B, domain 1;Fumarase/aspartase (N-terminal domain) 0.926 32 121 1.10.275.10
5xnzA01 Mainly Alpha;Orthogonal Bundle;Fumarase C; Chain B, domain 1;Fumarase/aspartase (N-terminal domain) 0.9149 22 121 1.10.275.10
1re5C02 Mainly Alpha;Up-down Bundle;Fumarase C; Chain A, domain 2;Fumarase/aspartase (Central domain) 0.9059 125 384 1.20.200.10
5xnzA02 Mainly Alpha;Up-down Bundle;Fumarase C; Chain A, domain 2;Fumarase/aspartase (Central domain) 0.9043 125 384 1.20.200.10
3c8tA02 Mainly Alpha;Up-down Bundle;Fumarase C; Chain A, domain 2;Fumarase/aspartase (Central domain) 0.9002 125 384 1.20.200.10
ID Description Score Start End GO Terms
AF-A0A6B3HGK4-F1-model_v4 3-carboxy-cis,cis-muconate cycloisomerase 0.9456 49 217 GO:0016829
GO:0016853
AF-A0A7Y5RKG5-F1-model_v4 3-carboxy-cis,cis-muconate cycloisomerase 0.9415 32 288 GO:0016829
GO:0016853
AF-A0A3C2BRF5-F1-model_v4 3-carboxy-cis,cis-muconate cycloisomerase 0.92 10 260 GO:0016829
GO:0016853
AF-A0A3C1KFM6-F1-model_v4 Adenylosuccinate lyase 0.9197 41 346 GO:0016829
AF-A0A259SU77-F1-model_v4 Adenylosuccinate lyase 0.9181 38 356 GO:0016829

Map