F248743

General Info

Members Datasets Scaffolds Average Seq Length
166 111 332 171

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10985337|Ga0307414_109853371
Length 193
Sequence MTAHQGTLRPAVHDRDHSLGPADAPVTLVEYGDFQCPFCARAHPIVTALRQRLGARLRFVFRNFPLTEIHPRAMPAAVAAESVAAHAGDAAYWAMHDAIFEHQRDSAHALDDEHLVQYATAAGADPRAVEKDLAGDAYQAQVRTEFLGGVRSGVNGTPTFFINGERFEGDWTDLAAFAAALEGAARQATAAPA

Samples

Sample ID Description Type Environment
1 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
35 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
42 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
43 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
44 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
45 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
46 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
47 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
48 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
49 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
50 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
51 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
52 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
53 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
54 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
55 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
56 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
57 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
58 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
59 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
60 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
61 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
62 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
63 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
64 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
65 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
66 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
67 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
68 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
69 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
70 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
71 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
72 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
73 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
74 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
75 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
76 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
77 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
78 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
79 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
91 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
92 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
93 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
94 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
95 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
96 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
97 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
98 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
99 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
100 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
101 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
103 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
104 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
107 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
108 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
109 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
110 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
111 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 0
Rhizosphere 98.19
Stem 0
Stem Tuber 0
Unclassified 16.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307414_10985337 3300032004 Bacteria 775
2 Ga0065712_10127575 3300005290 Bacteria 1589
3 Ga0070658_10086444 3300005327 Bacteria 2579
4 Ga0070676_10333380 3300005328 Bacteria 1038
5 Ga0070670_100354129 3300005331 Bacteria 1290
6 Ga0070680_100091688 3300005336 Bacteria 2515
7 Ga0070673_100379618 3300005364 Bacteria 1260
8 Ga0070703_10035430 3300005406 Bacteria 1528
9 Ga0070714_100473214 3300005435 Unclassified 1192
10 Ga0070713_100957141 3300005436 Bacteria 825
11 Ga0070705_100009909 3300005440 Archaea 4753
12 Ga0070694_100010202 3300005444 Bacteria 5784
13 Ga0070694_100492024 3300005444 Bacteria 975
14 Ga0070694_100658363 3300005444 Unclassified 848
15 Ga0070708_100347052 3300005445 Bacteria 1398
16 Ga0070708_100637360 3300005445 Bacteria 1004
17 Ga0070706_100234003 3300005467 Archaea 1715
18 Ga0070706_100507533 3300005467 Bacteria 1122
19 Ga0070707_100033583 3300005468 Bacteria 4892
20 Ga0070698_100163666 3300005471 Archaea 2168
21 Ga0070698_100650428 3300005471 Bacteria 995
22 Ga0070699_100002931 3300005518 Bacteria 15170
23 Ga0070699_100045207 3300005518 Bacteria 3811
24 Ga0070699_100073294 3300005518 Bacteria 2979
25 Ga0070699_100309122 3300005518 Archaea 1419
26 Ga0070697_100007407 3300005536 Bacteria 8546
27 Ga0070697_100097316 3300005536 Bacteria 2442
28 Ga0070697_100154129 3300005536 Unclassified 1938
29 Ga0070697_101328524 3300005536 Unclassified 641
30 Ga0070695_100012882 3300005545 Bacteria 5020
31 Ga0070695_100031088 3300005545 Bacteria 3326
32 Ga0070695_100040445 3300005545 Bacteria 2951
33 Ga0070695_100889373 3300005545 Bacteria 719
34 Ga0070696_100000464 3300005546 Bacteria 25407
35 Ga0070696_100007200 3300005546 Bacteria 7430
36 Ga0070696_100010615 3300005546 Bacteria 6168
37 Ga0070696_100074117 3300005546 Bacteria 2400
38 Ga0070696_100304543 3300005546 Unclassified 1221
39 Ga0070696_100372305 3300005546 Bacteria 1111
40 Ga0070696_100443085 3300005546 Bacteria 1023
41 Ga0070704_100024895 3300005549 Archaea 3932
42 Ga0070704_100130817 3300005549 Bacteria 1945
43 Ga0070704_100489662 3300005549 Bacteria 1065
44 Ga0070664_101100685 3300005564 Bacteria 748
45 Ga0070716_100933476 3300006173 Bacteria 682
46 Ga0075428_100381741 3300006844 Bacteria 1510
47 Ga0075428_101033404 3300006844 Bacteria 869
48 Ga0075433_10000360 3300006852 Bacteria 28644
49 Ga0075433_10037056 3300006852 Bacteria 4204
50 Ga0075433_10105959 3300006852 Bacteria 2491
51 Ga0075433_10638237 3300006852 Unclassified 934
52 Ga0075434_100049183 3300006871 Bacteria 4185
53 Ga0075434_100118659 3300006871 Bacteria 2659
54 Ga0075436_100061132 3300006914 Bacteria 2602
55 Ga0105245_10708232 3300009098 Bacteria 1040
56 Ga0105245_10972454 3300009098 Bacteria 893
57 Ga0114129_10642647 3300009147 Bacteria 1370
58 Ga0114129_10921498 3300009147 Bacteria 1106
59 Ga0114129_11295689 3300009147 Bacteria 903
60 Ga0105248_10027012 3300009177 Bacteria 6386
61 Ga0163162_11413932 3300013306 Unclassified 792
62 Ga0157372_10234717 3300013307 Bacteria 2127
63 Ga0157375_10401746 3300013308 Bacteria 1537
64 Ga0157379_10153826 3300014968 Bacteria 2075
65 Ga0157379_11328058 3300014968 Unclassified 695
66 Ga0207705_10195058 3300025909 Bacteria 1533
67 Ga0207684_10005697 3300025910 Bacteria 11440
68 Ga0207646_10011771 3300025922 Bacteria 8451
69 Ga0207646_10108423 3300025922 Bacteria 2491
70 Ga0207646_10856226 3300025922 Bacteria 808
71 Ga0207691_10731189 3300025940 Bacteria 834
72 Ga0207651_10072338 3300025960 Bacteria 2448
73 Ga0207678_11194659 3300026067 Unclassified 673
74 Ga0307407_10025609 3300031903 Bacteria 3111
75 Ga0307416_100036465 3300032002 Bacteria 3771
76 Ga0307416_100856265 3300032002 Unclassified 1007
77 Ga0307415_100564156 3300032126 Bacteria 1007
78 Ga0373934_0011823 3300035086 Unclassified 3288
79 Ga0373953_0051879 3300035117 Unclassified 1659
80 Ga0373955_0022201 3300035172 Bacteria 3216
81 Ga0373924_0110245 3300035410 Bacteria 1189
82 Ga0373933_0009372 3300035724 Bacteria 5348
83 Ga0373933_0308869 3300035724 Unclassified 1024
84 Ga0373937_0003243 3300036401 Bacteria 13633
85 Ga0373937_0448555 3300036401 Bacteria 1225
86 Ga0436364_1051254 3300037853 Unclassified 749
87 Ga0436365_1021620 3300039437 Unclassified 667
88 Ga0436360_0260019 3300039438 Bacteria 680
89 Ga0451576_0172529 3300045051 Bacteria 2257
90 Ga0451576_0762546 3300045051 Bacteria 1016
91 Ga0451576_1845607 3300045051 Bacteria 624
92 Ga0495592_0042563 3300046454 Bacteria 3401
93 Ga0495651_0076000 3300046462 Unclassified 2545
94 Ga0495653_0765515 3300046463 Bacteria 582
95 Ga0495580_0269674 3300046472 Bacteria 1163
96 Ga0495580_0366545 3300046472 Bacteria 974
97 Ga0495608_0372025 3300046511 Unclassified 877
98 Ga0495618_0317093 3300046514 Bacteria 966
99 Ga0495628_0025019 3300046516 Bacteria 4881
100 Ga0495628_0189598 3300046516 Bacteria 1552
101 Ga0495630_0000557 3300046517 Bacteria 27233
102 Ga0495630_0128903 3300046517 Unclassified 1921
103 Ga0495666_0196104 3300046526 Bacteria 929
104 Ga0495642_0227288 3300046528 Bacteria 815
105 Ga0495652_0133734 3300046529 Unclassified 1959
106 Ga0495665_0017519 3300046531 Bacteria 3853
107 Ga0495587_0008573 3300046536 Bacteria 6572
108 Ga0495645_0001813 3300046543 Bacteria 14525
109 Ga0495667_0006423 3300046559 Bacteria 7976
110 Ga0495635_0082803 3300046663 Bacteria 2196
111 Ga0495599_0028971 3300046678 Bacteria 3470
112 Ga0495599_0598263 3300046678 Bacteria 642
113 Ga0495623_0032149 3300046679 Bacteria 3372
114 Ga0495613_0208208 3300046689 Bacteria 1376
115 Ga0495600_0035302 3300046809 Unclassified 3246
116 Ga0495581_0034998 3300047315 Bacteria 2906
117 Ga0495674_0165764 3300047319 Bacteria 1846
118 Ga0495680_0485499 3300047322 Bacteria 841
119 Ga0495675_0043217 3300047444 Unclassified 2871
120 Ga0495684_0012798 3300047471 Bacteria 6474
121 Ga0501032_0034555 3300049569 Bacteria 3460
122 Ga0501033_0047873 3300049570 Bacteria 3177
123 Ga0501034_0444684 3300049571 Bacteria 1214
124 Ga0501036_0113270 3300049572 Bacteria 2292
125 Ga0501037_0038958 3300049573 Bacteria 3500
126 Ga0501039_0008008 3300049575 Bacteria 8053
127 Ga0501042_0014746 3300049578 Bacteria 5337
128 Ga0501043_0009770 3300049579 Bacteria 7519
129 Ga0501046_0067443 3300049580 Bacteria 2786
130 Ga0501047_0073927 3300049581 Bacteria 3281
131 Ga0501047_1039188 3300049581 Unclassified 632
132 Ga0501048_0002071 3300049582 Bacteria 15262
133 Ga0501067_0002892 3300049583 Bacteria 9451
134 Ga0501068_0004829 3300049584 Bacteria 7338
135 Ga0501070_0045170 3300049586 Bacteria 3664
136 Ga0501071_0020806 3300049587 Bacteria 4563
137 Ga0501072_0077974 3300049588 Bacteria 2623
138 Ga0501073_0002724 3300049589 Bacteria 13242
139 Ga0501074_0008386 3300049590 Bacteria 7491
140 Ga0501076_0180806 3300049592 Bacteria 1719
141 Ga0501225_0008292 3300049705 Bacteria 2988
142 Ga0501080_0034300 3300049742 Bacteria 4736
143 Ga0501080_0905687 3300049742 Unclassified 768
144 Ga0501083_0001881 3300049744 Bacteria 14428
145 Ga0501035_0888075 3300049822 Bacteria 706
146 Ga0501044_0071607 3300049823 Bacteria 3524
147 Ga0501044_1404746 3300049823 Unclassified 563
148 Ga0501284_00020 3300050005 Bacteria 91754
149 nmdc:mga05p37_38653_c1 3300050507 Bacteria 5855
150 nmdc:mga05p37_522285_c1 3300050507 Bacteria 1358
151 nmdc:mga05p37_535878_c1 3300050507 Bacteria 1336
152 nmdc:mga08y16_340271_c1 3300050511 Bacteria 1542
153 nmdc:mga08y16_407643_c1 3300050511 Bacteria 1390
154 nmdc:mga0n895_1093277_c1 3300050512 Bacteria 775
155 nmdc:mga0n895_123223_c1 3300050512 Bacteria 2614
156 nmdc:mga0n895_362034_c1 3300050512 Bacteria 1469
157 nmdc:mga0n895_461114_c1 3300050512 Bacteria 1282
158 nmdc:mga0rr50_868018_c1 3300050513 Unclassified 769
159 nmdc:mga08x19_139654_c1 3300050514 Unclassified 1636
160 nmdc:mga0a205_1106_c1 3300050515 Bacteria 22338
161 nmdc:mga0a205_210524_c1 3300050515 Bacteria 1833
162 nmdc:mga0a205_596513_c1 3300050515 Unclassified 958
163 nmdc:mga0a205_858932_c1 3300050515 Bacteria 754
164 nmdc:mga0a205_95340_c1 3300050515 Bacteria 2874
165 Ga0500655_036772 3300053133 Bacteria 954
166 Ga0501082_0074061 3300060353 Bacteria 2932
167 Ga0307414_10985337
168 Ga0065712_10127575
169 Ga0070658_10086444
170 Ga0070676_10333380
171 Ga0070670_100354129
172 Ga0070680_100091688
173 Ga0070673_100379618
174 Ga0070703_10035430
175 Ga0070714_100473214
176 Ga0070713_100957141
177 Ga0070705_100009909
178 Ga0070694_100010202
179 Ga0070694_100492024
180 Ga0070694_100658363
181 Ga0070708_100347052
182 Ga0070708_100637360
183 Ga0070706_100234003
184 Ga0070706_100507533
185 Ga0070707_100033583
186 Ga0070698_100163666
187 Ga0070698_100650428
188 Ga0070699_100002931
189 Ga0070699_100045207
190 Ga0070699_100073294
191 Ga0070699_100309122
192 Ga0070697_100007407
193 Ga0070697_100097316
194 Ga0070697_100154129
195 Ga0070697_101328524
196 Ga0070695_100012882
197 Ga0070695_100031088
198 Ga0070695_100040445
199 Ga0070695_100889373
200 Ga0070696_100000464
201 Ga0070696_100007200
202 Ga0070696_100010615
203 Ga0070696_100074117
204 Ga0070696_100304543
205 Ga0070696_100372305
206 Ga0070696_100443085
207 Ga0070704_100024895
208 Ga0070704_100130817
209 Ga0070704_100489662
210 Ga0070664_101100685
211 Ga0070716_100933476
212 Ga0075428_100381741
213 Ga0075428_101033404
214 Ga0075433_10000360
215 Ga0075433_10037056
216 Ga0075433_10105959
217 Ga0075433_10638237
218 Ga0075434_100049183
219 Ga0075434_100118659
220 Ga0075436_100061132
221 Ga0105245_10708232
222 Ga0105245_10972454
223 Ga0114129_10642647
224 Ga0114129_10921498
225 Ga0114129_11295689
226 Ga0105248_10027012
227 Ga0163162_11413932
228 Ga0157372_10234717
229 Ga0157375_10401746
230 Ga0157379_10153826
231 Ga0157379_11328058
232 Ga0207705_10195058
233 Ga0207684_10005697
234 Ga0207646_10011771
235 Ga0207646_10108423
236 Ga0207646_10856226
237 Ga0207691_10731189
238 Ga0207651_10072338
239 Ga0207678_11194659
240 Ga0307407_10025609
241 Ga0307416_100036465
242 Ga0307416_100856265
243 Ga0307415_100564156
244 Ga0373934_0011823
245 Ga0373953_0051879
246 Ga0373955_0022201
247 Ga0373924_0110245
248 Ga0373933_0009372
249 Ga0373933_0308869
250 Ga0373937_0003243
251 Ga0373937_0448555
252 Ga0436364_1051254
253 Ga0436365_1021620
254 Ga0436360_0260019
255 Ga0451576_0172529
256 Ga0451576_0762546
257 Ga0451576_1845607
258 Ga0495592_0042563
259 Ga0495651_0076000
260 Ga0495653_0765515
261 Ga0495580_0269674
262 Ga0495580_0366545
263 Ga0495608_0372025
264 Ga0495618_0317093
265 Ga0495628_0025019
266 Ga0495628_0189598
267 Ga0495630_0000557
268 Ga0495630_0128903
269 Ga0495666_0196104
270 Ga0495642_0227288
271 Ga0495652_0133734
272 Ga0495665_0017519
273 Ga0495587_0008573
274 Ga0495645_0001813
275 Ga0495667_0006423
276 Ga0495635_0082803
277 Ga0495599_0028971
278 Ga0495599_0598263
279 Ga0495623_0032149
280 Ga0495613_0208208
281 Ga0495600_0035302
282 Ga0495581_0034998
283 Ga0495674_0165764
284 Ga0495680_0485499
285 Ga0495675_0043217
286 Ga0495684_0012798
287 Ga0501032_0034555
288 Ga0501033_0047873
289 Ga0501034_0444684
290 Ga0501036_0113270
291 Ga0501037_0038958
292 Ga0501039_0008008
293 Ga0501042_0014746
294 Ga0501043_0009770
295 Ga0501046_0067443
296 Ga0501047_0073927
297 Ga0501047_1039188
298 Ga0501048_0002071
299 Ga0501067_0002892
300 Ga0501068_0004829
301 Ga0501070_0045170
302 Ga0501071_0020806
303 Ga0501072_0077974
304 Ga0501073_0002724
305 Ga0501074_0008386
306 Ga0501076_0180806
307 Ga0501225_0008292
308 Ga0501080_0034300
309 Ga0501080_0905687
310 Ga0501083_0001881
311 Ga0501035_0888075
312 Ga0501044_0071607
313 Ga0501044_1404746
314 Ga0501284_00020
315 nmdc:mga05p37_38653_c1
316 nmdc:mga05p37_522285_c1
317 nmdc:mga05p37_535878_c1
318 nmdc:mga08y16_340271_c1
319 nmdc:mga08y16_407643_c1
320 nmdc:mga0n895_1093277_c1
321 nmdc:mga0n895_123223_c1
322 nmdc:mga0n895_362034_c1
323 nmdc:mga0n895_461114_c1
324 nmdc:mga0rr50_868018_c1
325 nmdc:mga08x19_139654_c1
326 nmdc:mga0a205_1106_c1
327 nmdc:mga0a205_210524_c1
328 nmdc:mga0a205_596513_c1
329 nmdc:mga0a205_858932_c1
330 nmdc:mga0a205_95340_c1
331 Ga0500655_036772
332 Ga0501082_0074061

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13462

Thioredoxin_4

Thioredoxin

13

182

0.88

PF01323

DSBA

DSBA-like thioredoxin domain

72

182

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7uno-assembly1.cif.gz_A thiol-disulfide oxidoreductase tsda, c129s mutant, from corynebacterium diphtheriae 0.8963 19 169
5nyl-assembly2.cif.gz_B crystal structure of an atypical poplar thioredoxin-like2.1 active site mutant 0.8884 25 64
7unn-assembly1.cif.gz_A thiol-disulfide oxidoreductase tsda from corynebacterium diphtheriae 0.8869 19 169
4pwo-assembly1.cif.gz_A crystal structure of dsba from the gram positive bacterium corynebacterium diphtheriae 0.8861 19 169
3f4s-assembly1.cif.gz_A crystal structure of wolbachia pipientis alpha-dsba1 t172v 0.8731 9 169
ID Description Score Start End Superfamily
af_A4IB19_1_112_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9041 25 62 3.40.30.10
af_Q8I2W0_41_187_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.877 24 68 3.40.30.10
3eu4A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8721 15 171 3.40.30.10
af_Q4DFA1_30_153_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8709 27 62 3.40.30.10
af_Q9VSG9_507_623_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8521 27 62 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2P6VXK9-F1-model_v4 Formate/nitrite transporter 0.9694 13 169 GO:0005886
GO:0015499
AF-A0A2C6W9G1-F1-model_v4 deleted 0.9627 9 169
AF-A0A1C6RID9-F1-model_v4 Protein-disulfide isomerase 0.9605 8 170 GO:0016853
AF-A0A538LHJ0-F1-model_v4 Sodium:proton antiporter 0.9602 8 169 GO:0005886
GO:0006885
GO:0015385
AF-A0A328AX80-F1-model_v4 DsbA family protein 0.9588 9 170

Map