F247919

General Info

Members Datasets Scaffolds Average Seq Length
166 122 159 58

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_101584604|Ga0070698_1015846041
Length 69
Sequence MKNLIAGVRRFINDEEGVTAIEYGLIAALIAVVIIVATALVGTRLNCMFQRVADCLSGAGSGTCQTACP

Samples

Sample ID Description Type Environment
1 2738541280 Massilia sp. GV090 Isolate Unclassified
2 2738541300 Massilia sp. GV016 Isolate Unclassified
3 2738543018 Massilia sp. GV045 Isolate Unclassified
4 2738543030 Massilia sp. GV097 Isolate Unclassified
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
49 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
50 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
51 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
73 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
74 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
75 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
76 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
77 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
80 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
85 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
86 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
87 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
88 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
89 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
90 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
91 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
92 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
93 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
94 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
95 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
96 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
97 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
98 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
99 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
100 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
107 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
108 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
109 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
110 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
111 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
112 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
114 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
115 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
117 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
118 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
119 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
120 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
121 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
122 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.18
Metatranscriptomes 1.2
Isolates 3.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.28
Nodule 1.2
Rhizoplane 6.02
Rhizosphere 59.04
Stem 0
Stem Tuber 0
Unclassified 14.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1006327 3300002987 Bacteria 3563
2 JGI25151J46595_10000018 3300003187 Bacteria 238438
3 rootL2_10050461 3300003322 Bacteria 5127
4 rootL2_10073855 3300003322 Bacteria 1866
5 Ga0055529_1000390 3300003763 Bacteria 47242
6 Ga0055524_1000017 3300003775 Bacteria 235608
7 Ga0065165_1000805 3300005262 Bacteria 41844
8 Ga0070666_10444069 3300005335 Bacteria 936
9 Ga0068868_100624717 3300005338 Bacteria 957
10 Ga0070689_100439471 3300005340 Bacteria 1108
11 Ga0070714_100109998 3300005435 Bacteria 2439
12 Ga0070714_100464397 3300005435 Bacteria 1204
13 Ga0070714_100637571 3300005435 Unclassified 1025
14 Ga0070713_100122583 3300005436 Unclassified 2282
15 Ga0070713_100169356 3300005436 Bacteria 1956
16 Ga0070713_100442108 3300005436 Bacteria 1220
17 Ga0070713_100492527 3300005436 Unclassified 1156
18 Ga0070713_100660481 3300005436 Bacteria 996
19 Ga0070713_101028657 3300005436 Bacteria 795
20 Ga0070698_101584604 3300005471 Bacteria 607
21 Ga0070699_101404813 3300005518 Unclassified 640
22 Ga0070699_101956435 3300005518 Unclassified 536
23 Ga0070697_100774378 3300005536 Unclassified 848
24 Ga0070697_100929870 3300005536 Unclassified 772
25 Ga0068853_100891370 3300005539 Bacteria 854
26 Ga0070664_100200379 3300005564 Bacteria 1781
27 Ga0068857_100034179 3300005577 Bacteria 4498
28 Ga0068854_100967546 3300005578 Bacteria 752
29 Ga0068852_100454702 3300005616 Bacteria 1268
30 Ga0068861_100168931 3300005719 Bacteria 1811
31 Ga0081540_1052779 3300005983 Bacteria 1998
32 Ga0070717_10402495 3300006028 Unclassified 1230
33 Ga0075365_11154167 3300006038 Bacteria 545
34 Ga0070712_100172984 3300006175 Bacteria 1677
35 Ga0070712_101751156 3300006175 Bacteria 544
36 Ga0075367_10097618 3300006178 Bacteria 1793
37 Ga0075367_11062887 3300006178 Bacteria 517
38 Ga0075366_10057465 3300006195 Bacteria 2312
39 Ga0097621_100986408 3300006237 Bacteria 788
40 Ga0075370_10002539 3300006353 Bacteria 8487
41 Ga0075370_10333571 3300006353 Bacteria 904
42 Ga0075370_10338115 3300006353 Bacteria 898
43 Ga0075370_10536155 3300006353 Bacteria 707
44 Ga0068871_100582535 3300006358 Bacteria 1016
45 Ga0075436_100368662 3300006914 Bacteria 1037
46 Ga0075436_100840363 3300006914 Bacteria 685
47 Ga0099826_10000033 3300006948 Bacteria 120668
48 Ga0105240_10236381 3300009093 Bacteria 2120
49 Ga0105245_10284944 3300009098 Bacteria 1616
50 Ga0105243_12208069 3300009148 Bacteria 587
51 Ga0105241_10323702 3300009174 Unclassified 1330
52 Ga0105241_12051783 3300009174 Bacteria 564
53 Ga0105242_10145425 3300009176 Bacteria 2062
54 Ga0105248_10447195 3300009177 Bacteria 1456
55 Ga0105237_10001770 3300009545 Bacteria 27892
56 Ga0105237_10023008 3300009545 Bacteria 6391
57 Ga0105238_10090720 3300009551 Bacteria 3043
58 Ga0105239_10001595 3300010375 Bacteria 29974
59 Ga0105239_10003565 3300010375 Bacteria 19038
60 Ga0157374_11045879 3300013296 Bacteria 836
61 Ga0157378_10075163 3300013297 Bacteria 3041
62 Ga0157376_12117503 3300014969 Unclassified 601
63 Ga0182005_1004365 3300015265 Bacteria 4586
64 Ga0213872_10000369 3300021361 Bacteria 37812
65 Ga0209437_107603 3300025233 Bacteria 1755
66 Ga0209565_1005561 3300025263 Bacteria 3642
67 Ga0209565_1084801 3300025263 Bacteria 517
68 Ga0209455_1000037 3300025272 Bacteria 464097
69 Ga0209130_1000043 3300025284 Bacteria 254257
70 Ga0209130_1037082 3300025284 Bacteria 964
71 Ga0209675_1000580 3300025291 Bacteria 26405
72 Ga0209676_1000066 3300025292 Bacteria 317897
73 Ga0209025_1000010 3300025294 Bacteria 986612
74 Ga0209025_1000911 3300025294 Bacteria 45506
75 Ga0209564_1000107 3300025295 Bacteria 214040
76 Ga0209564_1001704 3300025295 Bacteria 20780
77 Ga0209256_1000018 3300025299 Bacteria 568467
78 Ga0207426_1081179 3300025302 Bacteria 879
79 Ga0207680_10326081 3300025903 Bacteria 1075
80 Ga0207693_10515498 3300025915 Bacteria 933
81 Ga0207649_10047449 3300025920 Bacteria 2643
82 Ga0207700_10104103 3300025928 Bacteria 2270
83 Ga0207700_10235132 3300025928 Bacteria 1560
84 Ga0207700_10249832 3300025928 Bacteria 1515
85 Ga0207700_10481023 3300025928 Unclassified 1097
86 Ga0207700_10766420 3300025928 Unclassified 862
87 Ga0207700_11018721 3300025928 Bacteria 741
88 Ga0207664_10091894 3300025929 Bacteria 2490
89 Ga0207664_10732683 3300025929 Bacteria 889
90 Ga0207686_10026419 3300025934 Bacteria 3386
91 Ga0207670_10393526 3300025936 Bacteria 1106
92 Ga0207689_10033541 3300025942 Bacteria 4266
93 Ga0207679_10109825 3300025945 Bacteria 2174
94 Ga0207677_10646821 3300026023 Bacteria 933
95 Ga0207639_11307854 3300026041 Bacteria 680
96 Ga0207675_100057027 3300026118 Bacteria 3644
97 Ga0209282_1000014 3300027666 Bacteria 207318
98 Ga0307515_10000837 3300028794 Bacteria 70694
99 Ga0307515_10324286 3300028794 Bacteria 1204
100 Ga0307509_10005663 3300031507 Bacteria 17247
101 Ga0307508_10073452 3300031616 Bacteria 2996
102 Ga0307516_10001773 3300031730 Bacteria 29682
103 Ga0307516_10133554 3300031730 Bacteria 2259
104 Ga0307516_10482612 3300031730 Bacteria 894
105 Ga0307516_10581291 3300031730 Bacteria 774
106 Ga0307518_10065023 3300031838 Bacteria 2646
107 Ga0307518_10081426 3300031838 Bacteria 2337
108 Ga0307416_100002615 3300032002 Bacteria 10404
109 Ga0307507_10058353 3300033179 Bacteria 3624
110 Ga0373951_0257776 3300035091 Unclassified 526
111 Ga0395905_0043366 3300037471 Bacteria 4220
112 Ga0436364_0341631 3300037853 Bacteria 2976
113 Ga0436361_0042270 3300039447 Bacteria 1701
114 Ga0436361_0933291 3300039447 Bacteria 35546
115 Ga0436362_0022563 3300039453 Bacteria 577
116 Ga0436362_0578725 3300039453 Bacteria 529
117 Ga0495590_0000038 3300046457 Bacteria 127040
118 Ga0495580_0225661 3300046472 Bacteria 1286
119 Ga0495580_0605796 3300046472 Bacteria 723
120 Ga0495584_0000268 3300046491 Bacteria 36911
121 Ga0495583_0065383 3300046506 Bacteria 1611
122 Ga0495654_0280024 3300046530 Bacteria 686
123 Ga0495597_0006324 3300046542 Bacteria 6135
124 Ga0495668_0000029 3300046616 Bacteria 279128
125 Ga0495659_0000097 3300046664 Bacteria 38513
126 Ga0495661_0137126 3300046665 Bacteria 1334
127 Ga0495658_0014071 3300046683 Bacteria 4079
128 Ga0495671_0000269 3300046692 Bacteria 43880
129 Ga0495636_0003928 3300047318 Bacteria 5798
130 Ga0495672_0000515 3300047320 Bacteria 44434
131 Ga0495683_0000823 3300047323 Bacteria 22092
132 Ga0495687_046205 3300047443 Bacteria 1881
133 Ga0496101_1011733 3300048904 Bacteria 653
134 Ga0496102_0421972 3300048905 Bacteria 1253
135 Ga0496104_0237968 3300048907 Bacteria 1733
136 Ga0496104_0487536 3300048907 Bacteria 1144
137 Ga0496104_0554994 3300048907 Bacteria 1059
138 Ga0496104_0905001 3300048907 Bacteria 787
139 Ga0496105_1151417 3300048908 Bacteria 573
140 Ga0496109_1917776 3300048912 Bacteria 525
141 Ga0496113_0552694 3300048916 Bacteria 923
142 Ga0496115_0946197 3300048918 Bacteria 662
143 Ga0496116_0031829 3300048919 Bacteria 3768
144 Ga0496116_0246608 3300048919 Bacteria 892
145 Ga0496118_0035353 3300048921 Bacteria 4058
146 Ga0496121_0524064 3300048924 Bacteria 747
147 Ga0496123_0303747 3300048926 Bacteria 760
148 Ga0496125_0370523 3300048928 Bacteria 848
149 Ga0501307_060047 3300049162 Bacteria 588
150 Ga0495678_078332 3300049459 Bacteria 1193
151 Ga0495682_0003211 3300049460 Bacteria 7342
152 Ga0495682_0036996 3300049460 Bacteria 1796
153 Ga0501316_049945 3300049532 Bacteria 600
154 nmdc:mga06z11_978091_c1 3300050494 Bacteria 516
155 nmdc:mga07m45_414182_c1 3300050496 Bacteria 782
156 nmdc:mga08x19_1276170_c1 3300050514 Unclassified 520
157 nmdc:mga08x19_228498_c1 3300050514 Bacteria 1280
158 Ga0500644_0465795 3300053088 Bacteria 554
159 Ga0500651_0672676 3300053093 Bacteria 556

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10050461 rootL2_100504614 54
2 3300003322 rootL2_10073855 rootL2_100738554 54
3 3300003763 Ga0055529_1000390 Ga0055529_10003905 54
4 3300005536 Ga0070697_100774378 Ga0070697_1007743781 54
5 3300006175 Ga0070712_100172984 Ga0070712_1001729844 54
6 3300025233 Ga0209437_107603 Ga0209437_1076034 54
7 3300025272 Ga0209455_1000037 Ga0209455_1000037239 54
8 3300035091 Ga0373951_0257776 Ga0373951_0257776_157_327 54
9 3300046491 Ga0495584_0000268 Ga0495584_0000268_20132_20302 54
10 3300046530 Ga0495654_0280024 Ga0495654_0280024_374_544 54
11 3300047318 Ga0495636_0003928 Ga0495636_0003928_3199_3372 54
12 3300049162 Ga0501307_060047 Ga0501307_060047_259_432 54
13 3300049460 Ga0495682_0003211 Ga0495682_0003211_3617_3787 54
14 3300049532 Ga0501316_049945 Ga0501316_049945_261_434 54
15 iso_pu_bacteria 2738541280 2738738286 54
16 iso_pu_bacteria 2738541300 2738842902 54
17 iso_pu_bacteria 2738543018 2739273650 54
18 iso_pu_bacteria 2738543030 2739342694 54
19 iso_pu_bacteria 8020938398 8020940403 54
20 iso_pu_bacteria 8020953355 8020955218 54
21 3300005340 Ga0070689_100439471 Ga0070689_1004394712 55
22 3300005435 Ga0070714_100109998 Ga0070714_1001099982 55
23 3300005435 Ga0070714_100464397 Ga0070714_1004643973 55
24 3300005435 Ga0070714_100637571 Ga0070714_1006375713 55
25 3300005436 Ga0070713_100122583 Ga0070713_1001225833 55
26 3300005436 Ga0070713_100169356 Ga0070713_1001693562 55
27 3300005436 Ga0070713_100442108 Ga0070713_1004421082 55
28 3300005436 Ga0070713_100492527 Ga0070713_1004925272 55
29 3300005436 Ga0070713_100660481 Ga0070713_1006604812 55
30 3300005436 Ga0070713_101028657 Ga0070713_1010286571 55
31 3300005518 Ga0070699_101404813 Ga0070699_1014048132 55
32 3300005536 Ga0070697_100929870 Ga0070697_1009298702 55
33 3300005983 Ga0081540_1052779 Ga0081540_10527793 55
34 3300006028 Ga0070717_10402495 Ga0070717_104024953 55
35 3300006175 Ga0070712_101751156 Ga0070712_1017511561 55
36 3300006353 Ga0075370_10333571 Ga0075370_103335711 55
37 3300006353 Ga0075370_10333571 Ga0075370_103335712 55
38 3300006914 Ga0075436_100368662 Ga0075436_1003686622 55
39 3300006914 Ga0075436_100840363 Ga0075436_1008403632 55
40 3300009098 Ga0105245_10284944 Ga0105245_102849442 55
41 3300009174 Ga0105241_10323702 Ga0105241_103237022 55
42 3300009177 Ga0105248_10447195 Ga0105248_104471952 55
43 3300009545 Ga0105237_10023008 Ga0105237_100230083 55
44 3300009551 Ga0105238_10090720 Ga0105238_100907203 55
45 3300010375 Ga0105239_10001595 Ga0105239_1000159525 55
46 3300014969 Ga0157376_12117503 Ga0157376_121175031 55
47 3300025915 Ga0207693_10515498 Ga0207693_105154981 55
48 3300025928 Ga0207700_10104103 Ga0207700_101041033 55
49 3300025928 Ga0207700_10235132 Ga0207700_102351322 55
50 3300025928 Ga0207700_10249832 Ga0207700_102498321 55
51 3300025928 Ga0207700_10481023 Ga0207700_104810232 55
52 3300025928 Ga0207700_10766420 Ga0207700_107664202 55
53 3300025928 Ga0207700_11018721 Ga0207700_110187212 55
54 3300025929 Ga0207664_10091894 Ga0207664_100918943 55
55 3300025929 Ga0207664_10732683 Ga0207664_107326831 55
56 3300025936 Ga0207670_10393526 Ga0207670_103935262 55
57 3300039453 Ga0436362_0578725 Ga0436362_0578725_302_478 55
58 3300046542 Ga0495597_0006324 Ga0495597_0006324_2356_2529 55
59 3300046664 Ga0495659_0000097 Ga0495659_0000097_19233_19406 55
60 3300046692 Ga0495671_0000269 Ga0495671_0000269_9310_9483 55
61 3300047320 Ga0495672_0000515 Ga0495672_0000515_19619_19792 55
62 3300048912 Ga0496109_1917776 Ga0496109_1917776_273_446 55
63 3300050514 nmdc:mga08x19_1276170_c1 nmdc:mga08x19_1276170_c1_18_191 55
64 3300050514 nmdc:mga08x19_228498_c1 nmdc:mga08x19_228498_c1_600_773 55
65 3300021361 Ga0213872_10000369 Ga0213872_1000036910 56
66 3300031730 Ga0307516_10482612 Ga0307516_104826122 56
67 3300037853 Ga0436364_0341631 Ga0436364_0341631_426_596 56
68 3300039447 Ga0436361_0042270 Ga0436361_0042270_341_535 56
69 3300039447 Ga0436361_0933291 Ga0436361_0933291_5900_6073 56
70 3300039453 Ga0436362_0022563 Ga0436362_0022563_65_235 56
71 3300046472 Ga0495580_0225661 Ga0495580_0225661_506_676 56
72 3300046472 Ga0495580_0605796 Ga0495580_0605796_20_190 56
73 3300046506 Ga0495583_0065383 Ga0495583_0065383_864_1034 56
74 3300047323 Ga0495683_0000823 Ga0495683_0000823_19262_19432 56
75 3300047443 Ga0495687_046205 Ga0495687_046205_1631_1801 56
76 3300048905 Ga0496102_0421972 Ga0496102_0421972_17_187 56
77 3300048907 Ga0496104_0237968 Ga0496104_0237968_963_1133 56
78 3300048907 Ga0496104_0905001 Ga0496104_0905001_54_224 56
79 3300048919 Ga0496116_0031829 Ga0496116_0031829_2463_2633 56
80 3300048924 Ga0496121_0524064 Ga0496121_0524064_348_518 56
81 3300049460 Ga0495682_0036996 Ga0495682_0036996_1121_1291 56
82 3300005335 Ga0070666_10444069 Ga0070666_104440692 57
83 3300005338 Ga0068868_100624717 Ga0068868_1006247172 57
84 3300005539 Ga0068853_100891370 Ga0068853_1008913703 57
85 3300005564 Ga0070664_100200379 Ga0070664_1002003793 57
86 3300005577 Ga0068857_100034179 Ga0068857_1000341795 57
87 3300005578 Ga0068854_100967546 Ga0068854_1009675462 57
88 3300005616 Ga0068852_100454702 Ga0068852_1004547022 57
89 3300005719 Ga0068861_100168931 Ga0068861_1001689313 57
90 3300006038 Ga0075365_11154167 Ga0075365_111541671 57
91 3300006178 Ga0075367_10097618 Ga0075367_100976182 57
92 3300006195 Ga0075366_10057465 Ga0075366_100574654 57
93 3300006237 Ga0097621_100986408 Ga0097621_1009864082 57
94 3300006353 Ga0075370_10002539 Ga0075370_1000253910 57
95 3300006353 Ga0075370_10338115 Ga0075370_103381152 57
96 3300006358 Ga0068871_100582535 Ga0068871_1005825352 57
97 3300009093 Ga0105240_10236381 Ga0105240_102363812 57
98 3300009148 Ga0105243_12208069 Ga0105243_122080691 57
99 3300009174 Ga0105241_12051783 Ga0105241_120517832 57
100 3300009176 Ga0105242_10145425 Ga0105242_101454252 57
101 3300009545 Ga0105237_10001770 Ga0105237_100017704 57
102 3300010375 Ga0105239_10003565 Ga0105239_1000356511 57
103 3300013296 Ga0157374_11045879 Ga0157374_110458792 57
104 3300013297 Ga0157378_10075163 Ga0157378_100751632 57
105 3300025263 Ga0209565_1084801 Ga0209565_10848011 57
106 3300025284 Ga0209130_1037082 Ga0209130_10370822 57
107 3300025291 Ga0209675_1000580 Ga0209675_100058011 57
108 3300025292 Ga0209676_1000066 Ga0209676_1000066295 57
109 3300025294 Ga0209025_1000911 Ga0209025_100091117 57
110 3300025295 Ga0209564_1000107 Ga0209564_100010741 57
111 3300025295 Ga0209564_1001704 Ga0209564_100170412 57
112 3300025903 Ga0207680_10326081 Ga0207680_103260812 57
113 3300025920 Ga0207649_10047449 Ga0207649_100474493 57
114 3300025934 Ga0207686_10026419 Ga0207686_100264193 57
115 3300025942 Ga0207689_10033541 Ga0207689_100335414 57
116 3300025945 Ga0207679_10109825 Ga0207679_101098253 57
117 3300026023 Ga0207677_10646821 Ga0207677_106468212 57
118 3300026041 Ga0207639_11307854 Ga0207639_113078542 57
119 3300026118 Ga0207675_100057027 Ga0207675_1000570275 57
120 3300028794 Ga0307515_10000837 Ga0307515_1000083752 57
121 3300028794 Ga0307515_10324286 Ga0307515_103242864 57
122 3300031507 Ga0307509_10005663 Ga0307509_1000566311 57
123 3300031616 Ga0307508_10073452 Ga0307508_100734524 57
124 3300031730 Ga0307516_10001773 Ga0307516_1000177323 57
125 3300031730 Ga0307516_10133554 Ga0307516_101335542 57
126 3300031730 Ga0307516_10581291 Ga0307516_105812913 57
127 3300032002 Ga0307416_100002615 Ga0307416_1000026159 57
128 3300033179 Ga0307507_10058353 Ga0307507_100583535 57
129 3300037471 Ga0395905_0043366 Ga0395905_0043366_3267_3449 57
130 3300046683 Ga0495658_0014071 Ga0495658_0014071_1205_1384 57
131 3300048907 Ga0496104_0487536 Ga0496104_0487536_849_1028 57
132 3300048907 Ga0496104_0554994 Ga0496104_0554994_37_216 57
133 3300048908 Ga0496105_1151417 Ga0496105_1151417_194_373 57
134 3300048918 Ga0496115_0946197 Ga0496115_0946197_106_288 57
135 3300050496 nmdc:mga07m45_414182_c1 nmdc:mga07m45_414182_c1_312_488 57
136 3300053088 Ga0500644_0465795 Ga0500644_0465795_61_240 57
137 3300053093 Ga0500651_0672676 Ga0500651_0672676_305_484 57
138 3300002987 JGI25159J45721_1006327 JGI25159J45721_10063273 58
139 3300003187 JGI25151J46595_10000018 JGI25151J46595_1000001821 58
140 3300003775 Ga0055524_1000017 Ga0055524_100001751 58
141 3300005262 Ga0065165_1000805 Ga0065165_100080535 58
142 3300005471 Ga0070698_101584604 Ga0070698_1015846041 58
143 3300005518 Ga0070699_101956435 Ga0070699_1019564352 58
144 3300006178 Ga0075367_11062887 Ga0075367_110628872 58
145 3300006353 Ga0075370_10536155 Ga0075370_105361552 58
146 3300006948 Ga0099826_10000033 Ga0099826_10000033109 58
147 3300015265 Ga0182005_1004365 Ga0182005_10043655 58
148 3300025263 Ga0209565_1005561 Ga0209565_10055612 58
149 3300025284 Ga0209130_1000043 Ga0209130_100004334 58
150 3300025294 Ga0209025_1000010 Ga0209025_100001030 58
151 3300025299 Ga0209256_1000018 Ga0209256_1000018427 58
152 3300025302 Ga0207426_1081179 Ga0207426_10811791 58
153 3300027666 Ga0209282_1000014 Ga0209282_100001410 58
154 3300031838 Ga0307518_10065023 Ga0307518_100650231 58
155 3300031838 Ga0307518_10081426 Ga0307518_100814263 58
156 3300046457 Ga0495590_0000038 Ga0495590_0000038_69793_69972 58
157 3300046616 Ga0495668_0000029 Ga0495668_0000029_126440_126616 58
158 3300046665 Ga0495661_0137126 Ga0495661_0137126_705_881 58
159 3300048904 Ga0496101_1011733 Ga0496101_1011733_339_521 58
160 3300048916 Ga0496113_0552694 Ga0496113_0552694_10_192 58
161 3300048919 Ga0496116_0246608 Ga0496116_0246608_187_369 58
162 3300048921 Ga0496118_0035353 Ga0496118_0035353_540_722 58
163 3300048926 Ga0496123_0303747 Ga0496123_0303747_65_247 58
164 3300048928 Ga0496125_0370523 Ga0496125_0370523_230_409 58
165 3300049459 Ga0495678_078332 Ga0495678_078332_344_520 58
166 3300050494 nmdc:mga06z11_978091_c1 nmdc:mga06z11_978091_c1_115_294 58

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04964

Flp_Fap

Flp/Fap pilin component

11

56

0.96

Feature Viewer

pLDDT pTM Quality
87.56 0.44 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map